Property Summary

Ligand Count 13
NCBI Gene PubMed Count 13
PubMed Score 26.59
PubTator Score 15.45

Knowledge Summary

Patent (3,914)

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.300 1.7e-14
Breast cancer 3.100 2.6e-02
Chronic Lymphocytic Leukemia -1.064 4.1e-03
cutaneous lupus erythematosus 1.500 7.8e-03
diabetes mellitus -1.700 2.3e-02
group 4 medulloblastoma -1.100 8.6e-03
hepatocellular carcinoma -1.200 1.1e-03
interstitial cystitis 1.500 8.4e-03
invasive ductal carcinoma 1.400 9.2e-03
juvenile dermatomyositis 1.071 6.2e-08
lung cancer -2.900 2.2e-05
lung carcinoma -3.200 3.5e-37
malignant mesothelioma -1.100 1.2e-03
oligodendroglioma 1.100 1.5e-09
ovarian cancer 1.100 2.3e-03
primary pancreatic ductal adenocarcinoma 1.173 3.5e-03
psoriasis -1.200 6.4e-06
Rheumatoid arthritis 1.800 2.5e-03
tuberculosis and treatment for 6 months 1.300 4.2e-06
ulcerative colitis -1.300 9.4e-03
urothelial carcinoma -1.600 1.3e-03

Gene RIF (9)

AA Sequence

MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRG      1 - 70
QDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIK     71 - 140
QILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYD    141 - 210
PITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEK    211 - 280
RPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMV    281 - 350
SKRFRFDDSLPNPHELVSDLLC                                                    351 - 372
//

Text Mined References (16)

PMID Year Title