Property Summary

NCBI Gene PubMed Count 13
Grant Count 15
R01 Count 13
Funding $1,973,677.5
PubMed Score 25.34
PubTator Score 15.45

Knowledge Summary

Patent (3,914)

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.800 0.003
hepatocellular carcinoma -1.200 0.001
chronic lymphosyte leukemia -1.900 0.000
urothelial carcinoma -1.600 0.001
malignant mesothelioma -1.100 0.001
cutaneous lupus erythematosus 1.500 0.008
astrocytoma 1.300 0.000
oligodendroglioma 1.100 0.000
medulloblastoma -1.100 0.004
juvenile dermatomyositis 1.071 0.000
primary pancreatic ductal adenocarcinoma 1.173 0.004
tuberculosis and treatment for 6 months 1.300 0.000
lung cancer -2.900 0.000
diabetes mellitus -1.700 0.023
Breast cancer 3.100 0.026
interstitial cystitis 1.600 0.000
psoriasis -1.200 0.000
lung carcinoma -3.200 0.000
invasive ductal carcinoma 1.400 0.009
ulcerative colitis -1.500 0.000
ovarian cancer 2.800 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
24086368 A significant interaction between variants in STK17B and PAX8, in papillary thyroid cancer susceptibility, is reported.
23398943 ChIP assays showed that in U937 cells MYB binds to a conserved element upstream of the DRAK2 transcription start site.
23122956 DRAK2 protein directly binds to the type I TGF-beta receptor and Knockdown of DRAK2 suppresses the tumorigenic ability of breast cancer cells.
21148796 DRAK2 and protein kinase D form a novel signaling module that controls calcium homeostasis following T cell activation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19638987 Regulation of the apoptosis-inducing kinase DRAK2 by cyclooxygenase-2 in colorectal cancer.
19542440 Strong suppression of T cell receptor signals during thymic selection caused by ectopic DRAK2 expression in a DRAK2 transgenic mouse model of autoimmune encephalomyelitis alters the responsiveness of peripheral T cells.
17182616 DRAK2 kinase activity is regulated in a calcium-dependent manner and that Ser(12) phosphorylation is necessary for optimal suppression of T cell activation by this kinase

AA Sequence

MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRG      1 - 70
QDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIK     71 - 140
QILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYD    141 - 210
PITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEK    211 - 280
RPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMV    281 - 350
SKRFRFDDSLPNPHELVSDLLC                                                    351 - 372
//

Publication (16)

PMID Year Title
24086368 2013 An epistatic interaction between the PAX8 and STK17B genes in papillary thyroid cancer susceptibility.
23398943 2013 The MYB oncogene can suppress apoptosis in acute myeloid leukemia cells by transcriptional repression of DRAK2 expression.
23122956 2012 DRAK2 participates in a negative feedback loop to control TGF-?/Smads signaling by binding to type I TGF-? receptor.
21148796 2011 Protein kinase D orchestrates the activation of DRAK2 in response to TCR-induced Ca2+ influx and mitochondrial reactive oxygen generation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638987 2009 Regulation of the apoptosis-inducing kinase DRAK2 by cyclooxygenase-2 in colorectal cancer.
19542440 2009 Altered thymic selection and increased autoimmunity caused by ectopic expression of DRAK2 during T cell development.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...