Property Summary

NCBI Gene PubMed Count 20
PubMed Score 32.20
PubTator Score 25.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
osteosarcoma 7950 7.7e-06
psoriasis 6694 2.8e-05
Disease Target Count Z-score Confidence
Antley-Bixler syndrome 16 3.441 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.689 7.7e-06
psoriasis -2.300 2.8e-05

Gene RIF (7)

AA Sequence

MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPE      1 - 70
PEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTP     71 - 140
KAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWT    141 - 210
RGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHL    211 - 280
ESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV                   281 - 335
//

Text Mined References (27)

PMID Year Title