Property Summary

NCBI Gene PubMed Count 33
PubMed Score 134.79
PubTator Score 19.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis 1.100 1.6e-02
aldosterone-producing adenoma -1.163 3.2e-02
group 3 medulloblastoma 1.200 1.7e-03
lung cancer 1.500 2.0e-03
Multiple myeloma 1.452 1.0e-04

Gene RIF (15)

AA Sequence

MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPD      1 - 70
KLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFES     71 - 140
RVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKEL    141 - 210
WARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSG    211 - 280
QVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINT    281 - 350
GKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC    351 - 420
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPS    421 - 490
LTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD                             491 - 535
//

Text Mined References (40)

PMID Year Title