Property Summary

NCBI Gene PubMed Count 27
Grant Count 2
Funding $153,500
PubMed Score 119.05
PubTator Score 19.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.452 0.000
tuberculosis and treatment for 6 months 1.600 0.002
lung cancer 1.500 0.002
group 3 medulloblastoma 1.200 0.002
aldosterone-producing adenoma -1.163 0.032

Synonym

Accession O94763 A8K805 H7BY42 Q8TC23 Q9UNU3
Symbols RMP
URI
NNX3
C19orf2
PPP1R19

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (11)

PMID Text
25605019 RMP status in tumors may be a useful marker in estimating prognosis in patients with hepatocellular carcinoma and in assisting in the selection of patients who are likely to benefit from adjuvant TACE to prevent relapse.
25527175 High URI1 expression is associated with epithelial ovarian cancer.
25453901 Results show that URI expression is essential for hepatocarcinogenesis and associated with poor survival.
24625985 URI may have an important role in the development of multiple myeloma and chemotherapeutic resistance through activation of the IL-6/STAT3 pathway.
24228101 Higher level of URI/RMP expression in high-grade endometrioid adenocarcinomas compared to tissues of adjacent endometrium or gland suggests a diagnostic and possibly, a prognostic value of URI/RMP in endometrioid adenocarcinoma.
21730289 Data show that while Art-27 can bind AR directly, URI is bound to chromatin prior to hormone-dependent recruitment of AR, suggesting a role for URI in modulating AR recruitment to target genes.
21397856 Data show that URI is an "addicting" oncogene selectively required for the survival of ovarian cancer cells with increased URI copy number.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
17936702 Data show that URI and PP1gamma are components of an S6K1-regulated mitochondrial pathway dedicated to oppose sustained S6K1 survival signaling and to ensure that the threshold for apoptosis is set based on nutrient and growth factor availability.
More...

AA Sequence

MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNALRERLSTLPD      1 - 70
KLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDLKKVMKNFES     71 - 140
RVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHKPHSKPKTSDIFEADIANDVKSKDLLADKEL    141 - 210
WARLEELERQEELLGELDSKPDTVIANGEDTTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSG    211 - 280
QVNSQLNCSVNGSSSYHSDDDDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINT    281 - 350
GKNTTLKFSEKKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC    351 - 420
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPS    421 - 490
LTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD                             491 - 535
//

Publication (34)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25605019 2015 RMP predicts survival and adjuvant TACE response in hepatocellular carcinoma.
25527175 2015 Characterization of the 19q12 amplification including CCNE1 and URI in different epithelial ovarian cancer subtypes.
25453901 2014 Inhibition of de novo NAD(+) synthesis by oncogenic URI causes liver tumorigenesis through DNA damage.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24625985 2014 URI regulates tumorigenicity and chemotherapeutic resistance of multiple myeloma by modulating IL-6 transcription.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24228101 2013 Expression analysis of URI/RMP gene in endometrioid adenocarcinoma by tissue microarray immunohistochemistry.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...