Property Summary

NCBI Gene PubMed Count 44
Grant Count 46
R01 Count 15
Funding $6,509,279.84
PubMed Score 55.73
PubTator Score 50.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.231 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.009
spina bifida -1.244 0.046
ovarian cancer -1.100 0.000

Gene RIF (32)

PMID Text
26844521 mutation associated with early myocardial infarction
26717024 RECQL5 has unique strand annealing properties relative to the other human RecQ helicase proteins
26686625 RECQL5 is a critical regulator of genome stability in myeloproliferative neoplasms and demonstrate that replication stress-associated cytotoxicity can be amplified specifically in JAK2V617F mutant cells through RECQL5-targeted synthetic lethality.
26586793 Expression of RECQL5 in breast cancer can drive proliferation supporting an oncogenic function for RECQL5 in breast cancer. RECQL5 is a promising biomarker in breast cancer.
26499077 results suggested RECQL5 as a tumor suppressor in osteosarcoma and may be a potential therapeutic target for osteosarcoma treatment
26391948 PARylation is involved in the recruitment of RECQL5 and WRN to laser-induced DNA damage and RECQL5 and WRN have differential responses to PARylated PARP1 and Poly(ADP-ribose).
25867335 The RECQL5 genetic polymorphism was associated with osteosarcoma in a Chinese population.
25851487 RecQ5 prevents transcription associated genome instability by facilitating PIAS1-SRSF1 ligase complex sumoylation of DNA topoisomerase 1.
25394896 The present study indicated that the RECQL5 genetic polymorphism and haplotypes were associated with breast cancer in a Chinese population.
24836610 The data presented here provide evidence that RECQL5 plays a general role in the control of transcript elongation in human cells. In its absence, transcript elongation rates increase, the distribution profile of RNAPII is markedly altered across the genome, and higher levels of RNAPII pausing or arrest (i.e., transcription stress) are detected.
More...

AA Sequence

MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPALLAK      1 - 70
GITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLEREKPQTKILYITPEMAASSSFQP     71 - 140
TLNSLVSRHLLSYLVVDEAHCVSQWGHDFRPDYLRLGALRSRLGHAPCVALTATATPQVQEDVFAALHLK    141 - 210
KPVAIFKTPCFRANLFYDVQFKELISDPYGNLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELS    211 - 280
CRGVNAKAYHAGLKASERTLVQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRA    281 - 350
GRDGKPSWCRLYYSRNDRDQVSFLIRKEVAKLQEKRGNKASDKATIMAFDALVTFCEELGCRHAAIAKYF    351 - 420
GDALPACAKGCDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGDFSRYDEGSGG    421 - 490
SGDEGRDEAHKREWNLFYQKQMQLRKGKDPKIEEFVPPDENCPLKEASSRRIPRLTVKAREHCLRLLEEA    491 - 560
LSSNRQSTRTADEADLRAKAVELEHETFRNAKVANLYKASVLKKVADIHRASKDGQPYDMGGSAKSCSAQ    561 - 630
AEPPEPNEYDIPPASHVYSLKPKRVGAGFPKGSCPFQTATELMETTRIREQAPQPERGGEHEPPSRPCGL    631 - 700
LDEDGSEPLPGPRGEVPGGSAHYGGPSPEKKAKSSSGGSSLAKGRASKKQQLLATAAHKDSQSIARFFCR    701 - 770
RVESPALLASAPEAEGACPSCEGVQGPPMAPEKYTGEEDGAGGHSPAPPQTEECLRERPSTCPPRDQGTP    771 - 840
EVQPTPAKDTWKGKRPRSQQENPESQPQKRPRPSAKPSVVAEVKGSVSASEQGTLNPTAQDPFQLSAPGV    841 - 910
SLKEAANVVVKCLTPFYKEGKFASKELFKGFARHLSHLLTQKTSPGRSVKEEAQNLIRHFFHGRARCESE    911 - 980
ADWHGLCGPQR                                                               981 - 991
//

Publication (50)

PMID Year Title
26844521 2016 Exome Sequencing in a Family Identifies RECQL5 Mutation Resulting in Early Myocardial Infarction.
26717024 2016 RECQL5 has unique strand annealing properties relative to the other human RecQ helicase proteins.
26686625 2015 RECQL5 Suppresses Oncogenic JAK2-Induced Replication Stress and Genomic Instability.
26586793 2016 Clinicopathological and prognostic significance of RECQL5 helicase expression in breast cancers.
26499077 2015 Decreased RECQL5 correlated with disease progression of osteosarcoma.
26391948 2015 Differential and Concordant Roles for Poly(ADP-Ribose) Polymerase 1 and Poly(ADP-Ribose) in Regulating WRN and RECQL5 Activities.
25867335 2015 Single nucleotide polymorphism in the RECQL5 gene increased osteosarcoma susceptibility in a Chinese Han population.
25851487 2015 RECQ5-dependent SUMOylation of DNA topoisomerase I prevents transcription-associated genome instability.
25394896 2014 Association between RECQL5 genetic polymorphisms and susceptibility to breast cancer.
24836610 2014 RECQL5 controls transcript elongation and suppresses genome instability associated with transcription stress.
More...