Property Summary

NCBI Gene PubMed Count 63
Grant Count 31
R01 Count 17
Funding $3,210,944.64
PubMed Score 130.74
PubTator Score 182.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis -1.386 0.003
astrocytic glioma 1.400 0.029
oligodendroglioma 1.100 0.006
esophageal adenocarcinoma 1.700 0.030
psoriasis -1.800 0.000
group 3 medulloblastoma -1.800 0.000
cystic fibrosis -1.736 0.001
glioblastoma -1.900 0.022
medulloblastoma, large-cell -2.200 0.001
adrenocortical carcinoma -1.462 0.006
non-small cell lung cancer -1.297 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.015
lung cancer -2.300 0.000
interstitial cystitis -1.300 0.003
Alzheimer's disease -1.400 0.019
Pick disease -1.500 0.000
progressive supranuclear palsy -1.200 0.012
ovarian cancer 2.800 0.000
chronic rhinosinusitis -1.032 0.014

Gene RIF (49)

PMID Text
26662939 The most significant associations were detected for PECAM1*V/V + DDAH1*C (OR = 4.17 CI 1.56-11.15 Pperm = 0.005)
26455824 results suggest that miR-21 may regulate renal fibrosis by the Wnt pathway via directly targeting DDAH1
26226438 FoxO1 regulates asymmetric dimethylarginine via downregulation of dimethylaminohydrolase 1 in HUVECs and subjects with carotid atherosclerosis.
26082478 Inhibiting the expression of DDAH1, but not DDAH2, resulted in a significant increase in the sensitivity of the EVT cell line SGHPL-4 to tumour necrosis factor related apoptosis inducing ligand (TRAIL) induced apoptosis
25424718 Genebased analyses revealed associations of the DDAH1 gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis.
25194333 increased ADMA levels in rheumatoid arthritis do not appear to relate to DDAH genetic polymorphisms
24260221 DDAH1 deficiency attenuates endothelial cell cycle progression and angiogenesis.
23892448 DDAH1 genotypes were closely related to asymmetric dimethylarginine levels, but not to measures of endothelium-dependent vasodilation in an elderly population.
23864585 Only the DDAH1-V1 transcript is responsible for ADMA metabolism, and transcript specific primers are recommended to determine DDAH1 mRNA expression.
23766377 the advanced glycation end products-receptor for advanced glycation end products-mediated reactive oxygen species generation could be involved in endothelial dysfunction in diabetic end-stage renal disease patients
More...

AA Sequence

MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES      1 - 70
LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV     71 - 140
GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD    141 - 210
KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN    211 - 280
KKVDS                                                                     281 - 285
//

Text Mined References (69)

PMID Year Title
26662939 2016 Genotype/allelic combinations as potential predictors of myocardial infarction.
26455824 2016 MicroRNA21 promotes interstitial fibrosis via targeting DDAH1: a potential role in renal fibrosis.
26226438 2015 FoxO1 regulates asymmetric dimethylarginine via downregulation of dimethylaminohydrolase 1 in human endothelial cells and subjects with atherosclerosis.
26082478 2015 Inhibition of DDAH1, but not DDAH2, results in apoptosis of a human trophoblast cell line in response to TRAIL.
25424718 2015 Associations of Endothelial System Genes With Blood Pressure Changes and Hypertension Incidence: The GenSalt Study.
25245031 2014 Genome-wide association study of L-arginine and dimethylarginines reveals novel metabolic pathway for symmetric dimethylarginine.
25194333 2014 Relationship between dimethylarginine dimethylaminohydrolase gene variants and asymmetric dimethylarginine in patients with rheumatoid arthritis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260221 2013 DDAH1 deficiency attenuates endothelial cell cycle progression and angiogenesis.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
More...