Property Summary

NCBI Gene PubMed Count 69
PubMed Score 144.41
PubTator Score 182.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.462 5.6e-03
Alzheimer's disease -1.400 1.9e-02
astrocytic glioma 1.400 2.9e-02
chronic rhinosinusitis -1.032 1.4e-02
cystic fibrosis -1.736 6.4e-04
esophageal adenocarcinoma 1.700 3.0e-02
glioblastoma -1.900 2.2e-02
group 3 medulloblastoma -1.800 3.2e-05
interstitial cystitis -1.300 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
lung cancer -2.300 1.7e-05
medulloblastoma, large-cell -2.200 1.3e-03
nephrosclerosis -1.386 2.8e-03
non-small cell lung cancer -1.297 7.6e-10
oligodendroglioma 1.100 5.5e-03
ovarian cancer 2.800 2.1e-05
Pick disease -1.500 1.5e-06
progressive supranuclear palsy -1.200 1.2e-02
psoriasis -1.800 4.1e-08

Synonym

Accession O94760 Q5HYC8 Q86XK5 DDAH-1
Symbols DDAH
DDAHI
DDAH-1
HEL-S-16

Gene

PANTHER Protein Class (1)

PDB

2JAI   2JAJ   3I2E   3I4A   3P8E   3P8P  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (54)

AA Sequence

MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGLQVVELPADES      1 - 70
LPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFV     71 - 140
GLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYD    141 - 210
KLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLIN    211 - 280
KKVDS                                                                     281 - 285
//

Text Mined References (75)

PMID Year Title