Property Summary

NCBI Gene PubMed Count 91
Grant Count 54
R01 Count 29
Funding $5,333,852.94
PubMed Score 21.63
PubTator Score 191.15

Knowledge Summary

Patent (17,620)


  Differential Expression (7)

Disease log2 FC p
ependymoma -1.300 0.000
glioblastoma -1.100 0.000
group 4 medulloblastoma -1.900 0.000
atypical teratoid/rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.300 0.000
lung adenocarcinoma 1.400 0.000


Accession O94759 D3DSL6 Q5KTC2 Q6J3P5 Q96KN6 Q96Q93
Symbols KNP3


PANTHER Protein Class (2)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2770 screening 0 / 0 / 3 Late stage counterscreen results from the probe development effort to identify selective agonists of the Transient Receptor Potential Channels 3 (TRPML3): other ion channel Fura-2 profiling assay

Gene RIF (80)

26656285 Data show that HEK293 cells expressing low levels of receptor potential melastatin 2 (TRPM2) channel were more susceptible to silica nanoparticles (NPs) than those expressing high levels of TRPM2.
26558786 In a transgenic mouse model of Alzheimer's disease, TRPM2 was involved in neuronal toxicity and memory impairment.
26311765 TRPM2 actively regulates the phosphorylation of GSK-3 in the brain.
26178079 This is expected to provide a basis for inhibiting TRPM2 for the improved treatment of breast cancer, which potentially includes treating breast tumors that are resistant to chemotherapy due to their evasion of apoptosis.
25760728 The HDACi-elicited upregulation of TRPM2 expression.
25760245 we report here a novel effect promoted by TRPM2, where it functions to minimize DNA damage and thus may have a role in the protection of genomic DNA in breast cancer cells.
25675998 VEGF-induced angiogenesis required reactive oxygen species generation in endothelial cells and resultant TRPM2 activation.
25620041 These findings shed new light on the evolution of TRPM2 and establish nvTRPM2 as a promising tool to decipher its complex gating mechanisms.
25576627 Ca2+ entry via Trpm2 channels was essential for maintenance of mitochondrial function in the heart.
25391657 TRPM2-L function may be a novel approach to reduce tumor growth through modulation of HIF-1/2a, mitochondrial function, and mitophagy.

AA Sequence

ASIRWQVVDRRIPLYANHKTLLQKAAAEFGAHY                                        1471 - 1503

Publication (94)

PMID Year Title
27383051 2016 The proposed channel-enzyme transient receptor potential melastatin 2 does not possess ADP ribose hydrolase activity.
27068538 2016 Reciprocal regulation of actin cytoskeleton remodelling and cell migration by Ca2+ and Zn2+: role of TRPM2 channels.
26656285 2015 A dual role of transient receptor potential melastatin 2 channel in cytotoxicity induced by silica nanoparticles.
26558786 2015 The Transient Receptor Potential Melastatin 2 (TRPM2) Channel Contributes to ?-Amyloid Oligomer-Related Neurotoxicity and Memory Impairment.
26311765 2015 TRPM2, a Susceptibility Gene for Bipolar Disorder, Regulates Glycogen Synthase Kinase-3 Activity in the Brain.
26178079 2015 Enhanced cytotoxicity in triple-negative and estrogen receptor?positive breast adenocarcinoma cells due to inhibition of the transient receptor potential melastatin-2 channel.
25918360 2015 Ruling out pyridine dinucleotides as true TRPM2 channel activators reveals novel direct agonist ADP-ribose-2'-phosphate.
25760728 2015 TRPM2 mediates histone deacetylase inhibition-induced apoptosis in bladder cancer cells.
25760245 2015 Inhibition of the transient receptor potential melastatin-2 channel causes increased DNA damage and decreased proliferation in breast adenocarcinoma cells.
25675998 2015 Novel role of reactive oxygen species-activated Trp melastatin channel-2 in mediating angiogenesis and postischemic neovascularization.