Property Summary

Ligand Count 3
NCBI Gene PubMed Count 101
PubMed Score 25.14
PubTator Score 191.15

Knowledge Summary

Patent (17,620)


  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 8.3e-10
ependymoma -1.300 9.5e-11
glioblastoma -1.100 1.2e-08
group 3 medulloblastoma -1.300 4.3e-05
lung adenocarcinoma 1.400 1.3e-07
medulloblastoma, large-cell -1.300 1.5e-04
primitive neuroectodermal tumor -1.300 3.4e-05

Gene RIF (90)

AA Sequence

ASIRWQVVDRRIPLYANHKTLLQKAAAEFGAHY                                        1471 - 1503

Text Mined References (103)

PMID Year Title