Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.13
PubTator Score 1.11

Knowledge Summary

Patent (1,007)



Accession O76099 Q15621 Q6IFP2 Q96R94
Symbols OR7C4


  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid

AA Sequence

VTPMLNPFIYSLRNTDMKRALGRLLSRATFFNGDITAGLS                                  281 - 320

Text Mined References (6)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9268701 1997 Molecular cloning and chromosomal mapping of olfactory receptor genes expressed in the male germ line: evidence for their wide distribution in the human genome.
9119360 1997 Specific repertoire of olfactory receptor genes in the male germ cells of several mammalian species.