Property Summary

NCBI Gene PubMed Count 20
Grant Count 21
R01 Count 6
Funding $5,646,901.16
PubMed Score 19.67
PubTator Score 348.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer -1.100 0.027
Waldenstrons macroglobulinemia 2.012 0.049
malignant mesothelioma 2.000 0.000
cutaneous lupus erythematosus 2.000 0.024
osteosarcoma -5.652 0.000
non-small cell lung cancer -1.431 0.000
lung cancer -2.000 0.000
interstitial cystitis 1.900 0.001
pancreatic carcinoma -1.100 0.027
lung carcinoma -1.200 0.000
ulcerative colitis 1.200 0.012
psoriasis 1.400 0.000

Gene RIF (8)

PMID Text
22365146 Regulation of cathepsins S and L by cystatin F during maturation of dendritic cells.
21344476 Transgenic cystatin F is expressed in model mice only during demyelination; in chronic demyelination, remyelinating ability is lost.
19192250 Data demonstrate the addition of N-linked sugars to an Asn-X-Cys motif in cystatin F and suggest that the mannose 6-phosphate sorting machinery is used to divert cystatin F from the secretory pathway and to mediate its uptake from extracellular pools.
18256700 A latent protease inhibitor which is itself regulated by proteolysis in the endocytic pathway.
16601115 analysis of reduction-dependent activation of human cystatin F
15752368 Cystatin F was not colocalized with cystatin C shich suggests distinct functions for these two cysteine protease inhibitors in U937 cells.
15212960 CST7 is secreted, but artificial modification of its C-terminus can induce its endocytic targeting.
12423348 cystatin F is an intracellular cysteine peptidase inhibitor with readily regulated expression

AA Sequence

MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLF      1 - 70
KESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVP     71 - 140
VLRCH                                                                     141 - 145
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22365146 2012 Regulation of cathepsins S and L by cystatin F during maturation of dendritic cells.
21344476 2011 Microglial cystatin F expression is a sensitive indicator for ongoing demyelination with concurrent remyelination.
19192250 2009 Glycosylation directs targeting and activation of cystatin f from intracellular and extracellular sources.
18256700 2008 Cystatin F is a cathepsin C-directed protease inhibitor regulated by proteolysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16601115 2006 Structural basis of reduction-dependent activation of human cystatin F.
15752368 2005 Inhibitory properties of cystatin F and its localization in U937 promonocyte cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15212960 2004 Cystatin F is secreted, but artificial modification of its C-terminus can induce its endocytic targeting.
More...