Property Summary

NCBI Gene PubMed Count 20
PubMed Score 21.02
PubTator Score 348.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 2.4e-02
interstitial cystitis 1.900 1.3e-03
lung cancer -1.200 1.9e-02
lung carcinoma -1.200 3.8e-13
malignant mesothelioma 2.000 2.5e-07
non-small cell lung cancer -1.431 2.0e-13
osteosarcoma -5.652 3.4e-07
pancreatic cancer -1.100 2.7e-02
pancreatic carcinoma -1.100 2.7e-02
psoriasis 1.400 1.5e-48
ulcerative colitis 1.200 1.2e-02
Waldenstrons macroglobulinemia 2.012 4.9e-02

Gene RIF (8)

AA Sequence

MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLF      1 - 70
KESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVP     71 - 140
VLRCH                                                                     141 - 145
//

Text Mined References (21)

PMID Year Title