Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
Funding $182,626.5
PubMed Score 39.89
PubTator Score 111.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.505 0.023
lung cancer 1.500 0.004
diabetes mellitus -1.800 0.001
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.600 0.001

Synonym

Accession O76095 O95442 Q6IB19 Q9P0Q4
Symbols PAR
hJT
HJTB
HSPC222

Gene

JTB

PDB

2KJX  

 GO Function (1)

Gene RIF (6)

PMID Text
23297497 Downregulation of the PAR expression increases the Bax/Bcl-2 ratio and Bax expression, and thus induces the G2-M phase arrest and apoptosis of PC3 cells.
22615844 Silencing of the JTB resulted in an increase in the phosphorylation of p65 in HepG2 cells.
22079049 The JTB structure has a distant relationship to the midkine/pleiotrophin fold, particularly in the conservation of distinctive disulfide bridge patterns.
21225229 Due to its involvement in cell cycle and its overexpression in several human cancers PAR could represent an attractive target for therapeutic intervention.
19487072 Overexpression of JTB conferred resistance to apoptosis induced by ultraviolet radiation
12586295 Among ten hepatocellular carcinoma cases with amplicon 1q21-q22, significant gene expression level of JTB, SHC1, CCT3 and COPA in the tumors than the paired adjacent non-malignant liver tissues.

AA Sequence

MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKT      1 - 70
TPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVR     71 - 140
KQIESI                                                                    141 - 146
//

Text Mined References (17)

PMID Year Title
23297497 2012 [Downregulation of PAR expression induces the apoptosis of human prostate cancer PC3 cells and increases the Bcl-2/Bax ratio].
22615844 2012 HBsAg inhibits the translocation of JTB into mitochondria in HepG2 cells and potentially plays a role in HCC progression.
22079049 2012 The structure of the extracellular domain of the jumping translocation breakpoint protein reveals a variation of the midkine fold.
21225229 2011 PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins.
19487072 2009 Interacting with HBsAg compromises resistance of jumping translocation breakpoint protein to ultraviolet radiation-induced apoptosis in 293FT cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17369841 2007 Characterization of Jumping translocation breakpoint (JTB) gene product isolated as a TGF-beta1-inducible clone involved in regulation of mitochondrial function, cell growth and cell death.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...