Property Summary

NCBI Gene PubMed Count 14
PubMed Score 43.35
PubTator Score 111.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus 1.400 3.2e-03
lung adenocarcinoma 1.100 1.2e-08
lung cancer 1.500 3.6e-03
ovarian cancer 1.600 1.4e-03
pancreatic ductal adenocarcinoma liver m... -1.505 2.3e-02

 GO Function (1)

Gene RIF (6)

AA Sequence

MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKT      1 - 70
TPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVR     71 - 140
KQIESI                                                                    141 - 146
//

Text Mined References (17)

PMID Year Title