Property Summary

NCBI Gene PubMed Count 27
PubMed Score 24.62
PubTator Score 23.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.064 1.1e-05
juvenile dermatomyositis 1.338 3.5e-13
lung adenocarcinoma 1.008 1.3e-04
lung cancer 1.600 2.5e-04
medulloblastoma, large-cell 1.200 3.2e-03
Multiple myeloma 1.431 1.2e-03
osteosarcoma 2.259 5.7e-07
ovarian cancer -1.400 2.7e-05
psoriasis 1.200 4.3e-04
Rheumatoid arthritis 1.200 4.6e-03
ulcerative colitis 1.200 8.1e-06

Gene RIF (10)

AA Sequence

MASGGSGGVSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINT      1 - 70
HTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQ     71 - 140
DDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACALIGQGQLNQAMKILQKAEDLCRRSL    141 - 210
SEDTDGTEEDPQAELAIIHGQMAYILQLQGRTEEALQLYNQIIKLKPTDVGLLAVIANNIITINKDQNVF    211 - 280
DSKKKVKLTNAEGVEFKLSKKQLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCR    281 - 350
EKQHTKAIELLQEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEE    351 - 420
DIDSAIEVFTQAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKDIHTLAQLISA    421 - 490
YSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGDSQPKEQGQGDLKKKKKKKKG    491 - 560
KLPKNYDPKVTPDPERWLPMRERSYYRGRKKGKKKDQIGKGTQGATAGASSELDASKTVSSPPTSPRPGS    561 - 630
AATVSASTSNIIPPRHQKPAGAPATKKKQQQKKKKGGKGGW                                 631 - 671
//

Text Mined References (41)

PMID Year Title