Property Summary

NCBI Gene PubMed Count 26
PubMed Score 23.33
PubTator Score 23.83

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
juvenile dermatomyositis 1189 3.52974893803456E-13
osteosarcoma 7933 5.68426874072232E-7
ovarian cancer 8492 1.46136361332755E-6
ulcerative colitis 2087 8.125571074752E-6
acute quadriplegic myopathy 1157 3.09601968519877E-5
lung adenocarcinoma 2714 1.27020290960861E-4
lung cancer 4473 2.50026913427707E-4
psoriasis 6685 4.27605003542907E-4
Multiple myeloma 1328 0.00115854242864213
medulloblastoma, large-cell 6234 0.00318898906558955
Rheumatoid Arthritis 1171 0.00458292413108097
Disease Target Count
Bone marrow failure syndrome 1 1


  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.005
Multiple myeloma 1.431 0.001
psoriasis 1.200 0.000
osteosarcoma 2.259 0.000
medulloblastoma, large-cell 1.200 0.003
juvenile dermatomyositis 1.338 0.000
acute quadriplegic myopathy 1.314 0.000
lung cancer 1.600 0.000
lung adenocarcinoma 1.008 0.000
ulcerative colitis 1.200 0.000
ovarian cancer 3.100 0.000


Accession O76094 G5E9Z8 Q7Z3C0 SRP72
Symbols BMFF


  Ortholog (12)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (9)

23125841 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle 72kDa protein (SRP72), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23048028 SRP68/72 heterodimers as major nuclear proteins whose binding of histone H4 tail is inhibited by H4R3 methylation.
22944692 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle 72kDa protein (SRP72), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22541560 A heterozygous mutation in SRP72 has a role in familial aplasia and myelodysplasia.
21073748 The study delineated the minimal region of SRP72 capable of forming a stable complex with an signal recognition particle RNA fragment.
20729213 Inhibitors of MAPK pathway ERK1/2 or p38 prevent the IL-1{beta}-induced up-regulation of SRP72 autoantigen in Jurkat cells.
18441046 Human signal recognition particle RNA with a single A240G change was unable to form a complex with full-length human SRP72.
16672232 Ninety-four amino acids near the C terminus of SRP68 mediated the binding to SRP72
15588816 Human SRP RNA bound with high affinity to a 63 amino acid residue region near the C terminus of SRP72

AA Sequence

AATVSASTSNIIPPRHQKPAGAPATKKKQQQKKKKGGKGGW                                 631 - 671

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23048028 2012 A novel histone H4 arginine 3 methylation-sensitive histone H4 binding activity and transcriptional regulatory function for signal recognition particle subunits SRP68 and SRP72.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.