Property Summary

NCBI Gene PubMed Count 26
PubMed Score 73.13
PubTator Score 26.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
oligodendroglioma 1.100 0.000
colon cancer -2.600 0.006
lung cancer -1.800 0.005
breast carcinoma -1.200 0.000
group 3 medulloblastoma 1.400 0.009
psoriasis -1.400 0.000
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.100 0.014
ovarian cancer 1.700 0.000

Gene

PANTHER Protein Class (2)

PDB

2HD1   2YY2   3DY8   3DYL   3DYN   3DYQ   3DYS   3JSI   3JSW   3K3E   3K3H   3N3Z   3QI3   3QI4   4E90   4G2J   4G2L   4GH6   4Y86   4Y87   4Y8C  

Gene RIF (14)

PMID Text
25799991 PDE9A can regulate cGMP signalling independent of the nitric oxide pathway, and its role in stress-induced heart disease suggests potential as a therapeutic target.
23333304 HIV-1 Vif downregulates the expression of phosphodiesterase 9A (PDE9A) in Vif-expression T cells
22960860 it is concluded that assessment of PDE5 and PDE9 expression may be useful in the differential diagnosis of benign and malignant breast disease and successful treatment of breast cancer
22328573 In vivo effects of PDE9A inhibition included reversal of the respective disruptions of working memory.
21736695 PDE9 is widely distributed in the urothelial epithelium of the human lower urinary tract and its potential roles may be different from those of PDE5.
21336703 Data show that PDE9A inhibitor, BAY-73-6691, significantly reduced basal and sickle cell (SCA) neutrophil adhesion; this was accompanied by decreased SCA neutrophil surface expressions of the L-selectin and CD11b adhesion molecules.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
19214142 PDE9A, is unlikely to play an important role in antidepressant outcome in this sample
19214142 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPAN      1 - 70
SERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQ     71 - 140
EGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMRE    141 - 210
ELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYH    211 - 280
DLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAI    281 - 350
CHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI    351 - 420
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDR    421 - 490
EKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM    491 - 560
KELQKKTDSLTSGATEKSRERSRDVKNSEGDCA                                         561 - 593
//

Text Mined References (34)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25799991 2015 Phosphodiesterase 9A controls nitric-oxide-independent cGMP and hypertrophic heart disease.
25416956 2014 A proteome-scale map of the human interactome network.
24746902 2014 Phosphodiesterase 9: insights from protein structure and role in therapeutics.
23025719 2012 Application of structure-based drug design and parallel chemistry to identify selective, brain penetrant, in vivo active phosphodiesterase 9A inhibitors.
22985069 2012 Structure-based discovery of highly selective phosphodiesterase-9A inhibitors and implications for inhibitor design.
22960860 2012 Evaluation of PDE5 and PDE9 expression in benign and malignant breast tumors.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22328573 2012 Phosphodiesterase 9A regulates central cGMP and modulates responses to cholinergic and monoaminergic perturbation in vivo.
21736695 2012 Phosphodiesterase type 9 (PDE9) in the human lower urinary tract: an immunohistochemical study.
More...