Property Summary

Ligand Count 148
NCBI Gene PubMed Count 26
PubMed Score 78.94
PubTator Score 26.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Bipolar Disorder 666
Disease Target Count
Impotence 46
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Asthma 385 0.0 0.9
Multiple Sclerosis 540 0.0 1.2
Disease Target Count Z-score Confidence
Autosomal recessive nonsyndromic deafness 8 6 3.389 1.7

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.300 1.8e-05
breast carcinoma -1.200 1.0e-05
colon cancer -2.600 5.5e-03
group 3 medulloblastoma 1.400 8.7e-03
invasive ductal carcinoma -1.100 1.4e-02
lung cancer -1.800 4.7e-03
malignant mesothelioma 1.700 2.0e-06
oligodendroglioma 1.100 2.4e-14
ovarian cancer 1.700 7.3e-07
psoriasis -1.400 4.6e-09

Gene RIF (14)

AA Sequence

MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAMVSIDPTMPAN      1 - 70
SERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRREGAFESGQVEPRPREPQGCYQ     71 - 140
EGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANHLAVLEKRVELEGLKVVEIEKCKSDIKKMRE    141 - 210
ELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYH    211 - 280
DLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAI    281 - 350
CHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI    351 - 420
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDR    421 - 490
EKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAM    491 - 560
KELQKKTDSLTSGATEKSRERSRDVKNSEGDCA                                         561 - 593
//

Text Mined References (34)

PMID Year Title