Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.96
PubTator Score 17.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.200 4.4e-04
astrocytic glioma -2.100 2.5e-02
Astrocytoma, Pilocytic -2.000 2.5e-04
atypical teratoid / rhabdoid tumor -2.600 7.8e-04
ependymoma -2.600 8.4e-03
glioblastoma -2.200 9.0e-05
group 4 medulloblastoma -2.200 7.6e-04
medulloblastoma, large-cell -3.500 2.1e-07
oligodendroglioma -1.300 2.2e-06
Pick disease -1.100 3.7e-02
primitive neuroectodermal tumor -2.000 2.3e-02
psoriasis 2.200 1.2e-09
subependymal giant cell astrocytoma -2.580 1.9e-02

 GO Function (1)

Gene RIF (7)

AA Sequence

MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLPDSPAAPK      1 - 70
LFGLLSSPLSSLARFFSHLLRRPPPEAPRRRLDFSPLLPALPAARLSRGHEELPGRLSLLLGAALALPGR     71 - 140
PSGGRPLRPPHPVAKPREEDATAGQSSPMPQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCF    141 - 210
CWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFL    211 - 280
RTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFD    281 - 350
DAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA                                    351 - 388
//

Text Mined References (24)

PMID Year Title