Property Summary

NCBI Gene PubMed Count 22
Grant Count 12
R01 Count 10
Funding $570,520.25
PubMed Score 19.03
PubTator Score 17.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.100 0.025
ependymoma -2.600 0.008
psoriasis 2.800 0.000
glioblastoma -3.200 0.000
oligodendroglioma -1.300 0.000
medulloblastoma -2.200 0.005
atypical teratoid / rhabdoid tumor -2.600 0.001
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.000 0.023
pediatric high grade glioma -2.500 0.000
pilocytic astrocytoma -2.000 0.000
subependymal giant cell astrocytoma -2.580 0.019
Pick disease -1.100 0.037

Gene RIF (5)

PMID Text
20627871 Observational study of gene-disease association. (HuGE Navigator)
18360038 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17126529 The major function of PKCI-1 is to modulate mu opioid receptor signaling pathway along with RGSZ1, rather than directly mediating the Galphaz RGSZ1 interaction.
14872136 NMR study
12379657 provide new evidence that RGSZ1 interacts not only with Galpha(z,) but also with Galpha(i), as supported by in vitro binding assays and functional studies

AA Sequence

MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLPDSPAAPK      1 - 70
LFGLLSSPLSSLARFFSHLLRRPPPEAPRRRLDFSPLLPALPAARLSRGHEELPGRLSLLLGAALALPGR     71 - 140
PSGGRPLRPPHPVAKPREEDATAGQSSPMPQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCF    141 - 210
CWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFL    211 - 280
RTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFD    281 - 350
DAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA                                    351 - 388
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20859254 2010 Molecular organization and dynamics of the melatonin MT? receptor/RGS20/G(i) protein complex reveal asymmetry of receptor dimers for RGS and G(i) coupling.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
18360038 2008 Identification of hypertension-susceptibility genes and pathways by a systemic multiple candidate gene approach: the millennium genome project for hypertension.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17126529 2007 RGSZ1 interacts with protein kinase C interacting protein PKCI-1 and modulates mu opioid receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...