Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 5
Funding $1,547,954
PubMed Score 4.17
PubTator Score 5.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.028
interstitial lung disease -1.900 0.011
Multiple myeloma 1.684 0.007
ependymoma 1.600 0.023
Barrett's esophagus -1.100 0.023
esophageal adenocarcinoma -1.700 0.020
psoriasis 1.200 0.001
osteosarcoma -1.257 0.000
adrenocortical carcinoma -1.291 0.000
primary pancreatic ductal adenocarcinoma 1.067 0.034
non-small cell lung cancer -1.486 0.000
lung cancer -1.700 0.000
group 4 medulloblastoma 1.200 0.008
spina bifida -1.210 0.044
invasive ductal carcinoma -1.100 0.004
ovarian cancer -1.500 0.000
Down syndrome 1.100 0.003
chronic rhinosinusitis -1.592 0.006
cystic fibrosis and chronic rhinosinusit... -1.407 0.008
pancreatic cancer 1.100 0.010
dermatomyositis -1.200 0.011

Gene RIF (5)

PMID Text
22665488 Zfand5 can enhance ARE-containing mRNA stability by competing with tristetraprolin for mRNA binding.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16194934 ZNF216 is a potent inhibitory factor for osteoclast differentiation and the mechanism is unlikely due to direct attenuation of the NF-kappa B pathway
14754897 redundant and distinct roles in regulating NFkappaB activation and apoptosis

AA Sequence

MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD      1 - 70
TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE     71 - 140
EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI    141 - 210
QRI                                                                       211 - 213
//

Text Mined References (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22665488 2012 The protein Zfand5 binds and stabilizes mRNAs with AU-rich elements in their 3'-untranslated regions.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16424905 2006 A novel ubiquitin-binding protein ZNF216 functioning in muscle atrophy.
More...