Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.05
PubTator Score 5.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma -1.291 1.8e-04
Barrett's esophagus -1.100 2.3e-02
chronic rhinosinusitis -1.430 6.5e-03
cystic fibrosis and chronic rhinosinusit... -1.045 2.9e-02
dermatomyositis -1.200 1.1e-02
Down syndrome 1.100 3.5e-03
ependymoma 1.600 2.3e-02
esophageal adenocarcinoma -1.700 2.0e-02
group 4 medulloblastoma 1.200 8.5e-03
interstitial lung disease -1.400 1.9e-02
invasive ductal carcinoma -1.100 4.0e-03
lung cancer -1.500 1.0e-03
Multiple myeloma 1.684 6.6e-03
non-small cell lung cancer -1.486 8.1e-20
osteosarcoma 1.107 2.3e-03
ovarian cancer -1.500 4.4e-04
pancreatic cancer 1.100 9.9e-03
primary pancreatic ductal adenocarcinoma 1.067 3.4e-02
psoriasis 1.200 5.3e-04
Rheumatoid arthritis 1.200 2.8e-02
spina bifida -1.210 4.4e-02

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD      1 - 70
TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE     71 - 140
EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI    141 - 210
QRI                                                                       211 - 213
//

Text Mined References (18)

PMID Year Title