1. Home
  2. Targets
  3. signaling molecule
  4. AN1-type zinc finger protein 5

Tbio AN1-type zinc finger protein 5

Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.

 Comments

Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.17
PubTator Score 5.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
non-small cell lung cancer 2798 8.08160107960883E-20
lung cancer 4473 7.19868693881237E-5
adrenocortical carcinoma 1427 1.76444818807433E-4
osteosarcoma 7933 2.80657081236125E-4
ovarian cancer 8492 4.37367088726972E-4
psoriasis 6685 5.30096590738651E-4
Down syndrome 548 0.00346054388640778
invasive ductal carcinoma 2950 0.00403956087856206
chronic rhinosinusitis 512 0.00551556387844783
Multiple myeloma 1328 0.0065995840210342
cystic fibrosis and chronic rhinosinusitis 213 0.00816043278918144
group 4 medulloblastoma 1875 0.00845553202254765
pancreatic cancer 2300 0.0099222180558782
interstitial lung disease 292 0.0105407102427904
dermatomyositis 967 0.0114542624555067
esophageal adenocarcinoma 737 0.0195207517873976
Barrett's esophagus 185 0.0225813210328532
ependymoma 2514 0.0232581097946273
Rheumatoid Arthritis 1171 0.0279082684643991
primary pancreatic ductal adenocarcinoma 1271 0.0341618152223176
spina bifida 1064 0.0443682040447914

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.028
interstitial lung disease -1.900 0.011
Multiple myeloma 1.684 0.007
ependymoma 1.600 0.023
Barrett's esophagus -1.100 0.023
esophageal adenocarcinoma -1.700 0.020
psoriasis 1.200 0.001
osteosarcoma -1.257 0.000
adrenocortical carcinoma -1.291 0.000
primary pancreatic ductal adenocarcinoma 1.067 0.034
non-small cell lung cancer -1.486 0.000
lung cancer -1.700 0.000
group 4 medulloblastoma 1.200 0.008
spina bifida -1.210 0.044
invasive ductal carcinoma -1.100 0.004
ovarian cancer -1.500 0.000
Down syndrome 1.100 0.003
chronic rhinosinusitis -1.592 0.006
cystic fibrosis and chronic rhinosinusit... -1.407 0.008
pancreatic cancer 1.100 0.010
dermatomyositis -1.200 0.011

Synonym

Accession O76080 A8K484
Symbols ZA20D2
ZNF216
ZFAND5A

Gene

ZFAND5

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (2)

 GO Component (1)

 GO Process (8)

 Compartment GO Term (9)

 MGI Term (10)

 HCA RNA Cell Line (56)

See all...

Pathway (3)

 UniProt Keyword (9)

Gene RIF (5)

PMID Text
22665488 Zfand5 can enhance ARE-containing mRNA stability by competing with tristetraprolin for mRNA binding.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16194934 ZNF216 is a potent inhibitory factor for osteoclast differentiation and the mechanism is unlikely due to direct attenuation of the NF-kappa B pathway
14754897 redundant and distinct roles in regulating NFkappaB activation and apoptosis

AA Sequence 

MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD      1 - 70
TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE     71 - 140
EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI    141 - 210
QRI                                                                       211 - 213
//

Text Mined References (18)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22665488 2012 The protein Zfand5 binds and stabilizes mRNAs with AU-rich elements in their 3'-untranslated regions.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16424905 2006 A novel ubiquitin-binding protein ZNF216 functioning in muscle atrophy.
More...