Property Summary

NCBI Gene PubMed Count 42
PubMed Score 58.74
PubTator Score 51.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.08133733619153E-44
non-small cell lung cancer 2798 2.92024307555269E-24
lung adenocarcinoma 2714 4.63743202906743E-7
Atopic dermatitis 944 1.50822539478483E-4
fibroadenoma 557 2.04523445072649E-4
cutaneous lupus erythematosus 1056 2.99818612310214E-4
limb girdle muscular dystrophy 2I 56 6.80780967665184E-4
ductal carcinoma in situ 1745 0.0011253950978981
acute quadriplegic myopathy 1157 0.00118849551474263
lung cancer 4473 0.00142078111655201
invasive ductal carcinoma 2950 0.00295901157738389
aldosterone-producing adenoma 664 0.00687670194406204
Becker muscular dystrophy 187 0.0119229746380074
breast carcinoma 1614 0.0308762000236762
Disease Target Count Z-score Confidence
Cancer 2346 3.142 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.600 0.000
cutaneous lupus erythematosus -2.300 0.000
limb girdle muscular dystrophy 2I 1.502 0.001
Becker muscular dystrophy 1.098 0.012
acute quadriplegic myopathy 1.067 0.001
Atopic dermatitis -3.200 0.000
non-small cell lung cancer -2.752 0.000
lung cancer -1.500 0.001
breast carcinoma -1.300 0.031
fibroadenoma -3.700 0.000
aldosterone-producing adenoma -1.691 0.007
lung adenocarcinoma -2.600 0.000
ductal carcinoma in situ -2.800 0.001
invasive ductal carcinoma -3.000 0.003

Synonym

Accession O76076 B2R9N4 E1P612 Q6PEG3 WISP-2
Symbols CCN5
CT58
CTGF-L

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Gene RIF (31)

PMID Text
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26218313 Report opposing effects of CCN2 and CCN5 on fibroblast proliferation and transdifferentiation induced by TGF-beta.
25509878 The obtained results indicate that the changes in gene expression in bone marrow progenitor cells can be involved into space flight-induced osteopenia.
25132260 Activation of CCN5 may have the therapeutic potential to kill triple-negative breast cancer.
25089371 Serum WISP2 correlated directly with fatty acid binding protein 4. Serum SFRP5 did not differ between obese (n=32) vs. nonobese (n=25) PCOS women, but reference women had lower SFRP5 (p<5x10(-6) as compared to both PCOS groups).
24931170 WISP2 has a role in regulating tumor cell susceptibility through EMT by inducing the TGF-beta signaling pathway, KLF-4 expression and miR-7 inhibition.
24498388 Loss of WISP2 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype.
24451367 WISP2 exerts dual actions in mesenchymal precursor cells; secreted WISP2 activates canonical WNT and maintains the cells in an undifferentiated state, whereas cytosolic WISP2 regulates adipogenic commitment.
24276150 We demonstrate that the overexpression of CCN5 in lung fibroblasts suppresses the upregulation in the expression of alpha-SMA and collagen induced by CCN2.
23893926 Regulation of invasion by WISP2 may involve the WNT signalling pathway.
More...

AA Sequence

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVC      1 - 70
DASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRL     71 - 140
PSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGL    141 - 210
GMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF                                  211 - 250
//

Text Mined References (43)

PMID Year Title
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26218313 2015 CCN2 and CCN5 exerts opposing effect on fibroblast proliferation and transdifferentiation induced by TGF-?.
25509878 [The effects of simulated microgravity on the pattern of gene expression in human bone marrow mesenchymal stem cells under osteogenic differentiation].
25132260 2015 CCN5/WISP-2 promotes growth arrest of triple-negative breast cancer cells through accumulation and trafficking of p27(Kip1) via Skp2 and FOXO3a regulation.
25089371 2015 Roles of circulating WNT-signaling proteins and WNT-inhibitors in human adiposity, insulin resistance, insulin secretion, and inflammation.
24931170 2015 Targeting WNT1-inducible signaling pathway protein 2 alters human breast cancer cell susceptibility to specific lysis through regulation of KLF-4 and miR-7 expression.
24498388 2014 Loss of WISP2/CCN5 in estrogen-dependent MCF7 human breast cancer cells promotes a stem-like cell phenotype.
24451367 2014 The Novel Secreted Adipokine WNT1-inducible Signaling Pathway Protein 2 (WISP2) Is a Mesenchymal Cell Activator of Canonical WNT.
24276150 2014 CCN5 overexpression inhibits profibrotic phenotypes via the PI3K/Akt signaling pathway in lung fibroblasts isolated from patients with idiopathic pulmonary fibrosis and in an in vivo model of lung fibrosis.
23893926 A role for WISP2 in colorectal cancer cell invasion and motility.
More...