Property Summary

NCBI Gene PubMed Count 44
PubMed Score 66.54
PubTator Score 51.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.067 1.2e-03
aldosterone-producing adenoma -1.691 6.9e-03
Atopic dermatitis -3.200 1.5e-04
Becker muscular dystrophy 1.098 1.2e-02
breast carcinoma -1.300 3.1e-02
cutaneous lupus erythematosus -2.300 3.0e-04
ductal carcinoma in situ -2.800 1.1e-03
fibroadenoma -3.700 2.0e-04
invasive ductal carcinoma -3.000 3.0e-03
limb girdle muscular dystrophy 2A 1.319 1.9e-05
lung adenocarcinoma -2.600 4.6e-07
lung cancer -1.500 1.4e-03
non-small cell lung cancer -2.752 2.9e-24
psoriasis -1.400 2.0e-03

Gene RIF (33)

AA Sequence

MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVC      1 - 70
DASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRL     71 - 140
PSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGL    141 - 210
GMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF                                  211 - 250
//

Text Mined References (45)

PMID Year Title