Property Summary

NCBI Gene PubMed Count 56
PubMed Score 60.82
PubTator Score 136.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.5e-06
psoriasis 6694 8.0e-05
Pick disease 1894 1.0e-04
lung cancer 4740 6.6e-03
group 3 medulloblastoma 4104 2.7e-02

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.200 2.7e-02
lung cancer 1.100 6.6e-03
osteosarcoma -2.210 1.5e-06
Pick disease -1.100 1.0e-04
psoriasis -1.700 8.0e-05

Protein-protein Interaction (6)

Gene RIF (35)

AA Sequence

MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYFPSVPDNAELV      1 - 70
LLTLGQAWQGYVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQRLLADLLHNVSQNIAAETRAEDPP     71 - 140
WFEGLESRFQSKSGYLRYSCESRIRSYLREVSSYPSTVGAEAQEEFLRVLGSMCQRLRSMQYNGSYFDRG    141 - 210
AKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQD    211 - 280
GREVDWEYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ                281 - 338
//

Text Mined References (59)

PMID Year Title