Property Summary

NCBI Gene PubMed Count 96
Grant Count 26
R01 Count 13
Funding $4,275,586.82
PubMed Score 178.57
PubTator Score 103.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
astrocytic glioma -1.800 0.005
ependymoma -2.300 0.004
oligodendroglioma -2.000 0.005
psoriasis -1.200 0.001
glioblastoma -2.100 0.000
group 4 medulloblastoma -2.300 0.000
atypical teratoid/rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.600 0.000
interstitial cystitis -2.400 0.000
adult high grade glioma -2.300 0.001
pilocytic astrocytoma -2.100 0.000
Pick disease -1.200 0.000
ductal carcinoma in situ -1.100 0.002

Gene RIF (74)

PMID Text
26976983 Study shows an overexpression of SNCG in bladder cancer (BC) tissues which correlates positively with neoplasm recurrence. SNCG seems a good marker to predict recurrence of BC, but not a reliable one for staging or prediction of survival rate.
26521046 down-regulation of gamma-synuclein reduces the protein level of PLCbeta but increases the transcript level over 40 fold
26299756 the conformational dynamics of ERalpha36 in the absence and presence of Hsp90 and gammaSyn, is reported.
26191236 Data suggest that both BubR1 and SNCG may be promising predictive marker rather than prognostic marker in patients with breast cancer.
25997706 SNCG may promote MCF7 cell migration through activating the Erk pathway and breaking cell-cell junctions.
25956278 High gamma-Synuclein expression is associated with invasiveness in colon adenocarcinoma.
25756178 Synuclein-gamma shares some, but not all, gene regulators with leptin and is a PPARgamma target in adipocytes but not dorsal root ganglia neurons.
25499222 These results advance our understanding of the role of lncRNA-AK058003 as a regulator of hypoxia signaling, and this newly identified hypoxia/lncRNA-AK058003/SNCG pathway may help in the development of new therapeutics.
25479371 SNCG is highly expressed in bladder cancer tissue and its expression is stage-specific, but it is not helpful for predicting outcome in bladder cancer patients.
25400739 SNCG, MAP2, SDF-1 and CXCR4 may play an important role in the carcinogenesis, progression, invasion and metastasis of gastric adenocarcinoma.
More...

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAV      1 - 70
VSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD                  71 - 127
//

Text Mined References (98)

PMID Year Title
26976983 2016 Expression of ?-Synuclein in Bladder Carcinoma: A Possible Marker for Prognosis.
26521046 2016 The Breast Cancer Susceptibility Gene Product (?-Synuclein) Alters Cell Behavior through its [corrected] Interaction with Phospholipase C?.
26299756 2015 Structural insights into tumor-specific chaperoning activity of gamma synuclein in protecting estrogen receptor alpha 36 and its role in tamoxifen resistance in breast cancer.
26191236 2015 Predictive and prognostic values of BubR1 and synuclein-gamma expression in breast cancer.
25997706 2015 Synuclein-? promotes migration of MCF7 breast cancer cells by activating extracellular-signal regulated kinase pathway and breaking cell-cell junctions.
25956278 2015 ?-Synuclein confers both pro-invasive and doxorubicin-mediated pro-apoptotic properties to the colon adenocarcinoma LS 174T cell line.
25756178 2015 Evaluation of the synuclein-? (SNCG) gene as a PPAR? target in murine adipocytes, dorsal root ganglia somatosensory neurons, and human adipose tissue.
25499222 2014 Hypoxia-inducible lncRNA-AK058003 promotes gastric cancer metastasis by targeting ?-synuclein.
25479371 2014 Identification of ?-synuclein as a stage-specific marker in bladder cancer by immunohistochemistry.
25400739 2014 Expression of SNCG, MAP2, SDF-1 and CXCR4 in gastric adenocarcinoma and their clinical significance.
More...