Property Summary

NCBI Gene PubMed Count 101
PubMed Score 187.35
PubTator Score 103.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.300 5.7e-04
astrocytic glioma -1.800 4.7e-03
Astrocytoma, Pilocytic -2.100 1.9e-06
atypical teratoid / rhabdoid tumor -1.400 7.1e-08
ductal carcinoma in situ -1.100 2.4e-03
ependymoma -2.300 3.8e-03
glioblastoma -2.100 2.4e-09
group 3 medulloblastoma -1.700 2.5e-02
interstitial cystitis -1.700 1.3e-03
malignant mesothelioma 1.700 1.4e-06
medulloblastoma, large-cell -1.600 8.3e-06
oligodendroglioma -2.000 5.1e-03
Pick disease -1.200 2.8e-04
psoriasis -1.200 7.2e-04

Synonym

Accession O76070 O15104 Q96P61
Symbols SR
BCSG1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (79)

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAV      1 - 70
VSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD                  71 - 127
//

Text Mined References (103)

PMID Year Title