Property Summary

NCBI Gene PubMed Count 70
Grant Count 27
R01 Count 22
Funding $1,696,122.23
PubMed Score 64.03
PubTator Score 16.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (49)

PMID Text
26734725 The interaction of MDC1 with RNF8, but not with ATM requires WRAP53beta, suggesting that WRAP53beta facilitates the former interaction without altering phosphorylation of MDC1 by ATM.
26507658 These findings elucidate deeply and extensively the mechanism of RNF8/RNF168 and USP11 to maintain the proper status of ubiquitylation gammaH2AX to repair double strand breaks.
26381412 define a novel function for ATDC in the RNF8-mediated DNA damage response and implicate RNF8 binding as a key determinant of the radioprotective function of ATDC
25955491 Results indicate that RNF8 recruits and ubiquitinates many factors to repair DNA damage thereby conferring radioresistance to nasopharyngeal cancer cells.
25483088 our results indicate that down-regulation of RNF8 mediated by miR-214 impedes DNA damage response to induce chromosomal instability in ovarian cancers, which may facilitate the understanding of mechanisms underlying chromosomal instability.
25417706 Significantly restored tolerance of RAD18-/- and RNF8-/- cells to camptothecin and olaparib without affecting Rad51 focus formation.
25374327 considered potential associations of 14 single nucleotide polymorphisms (SNPs) in RNF8 and BRDT genes in Chinese patients with non-obstructive azoospermia
25337968 Depletion of RNF8 or RNF168 blocks the degradation of diffusely localized nuclear 53BP1.
25304081 Finding that RNF8 is less abundant than RNF168 identifies RNF8 as a rate-limiting determinant of focal repair complex assembly.
23615962 findings implicate USP44 in negative regulation of the RNF8/RNF168 pathway
More...

AA Sequence

MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNP      1 - 70
EGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKN     71 - 140
DQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTAL    141 - 210
EPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKG    211 - 280
NSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWAL    281 - 350
MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH    351 - 420
SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF         421 - 485
//

Text Mined References (79)

PMID Year Title
26869104 2016 VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage.
26734725 2015 The proximity ligation assay reveals that at DNA double-strand breaks WRAP53? associates with ?H2AX and controls interactions between RNF8 and MDC1.
26507658 2016 USP11 Is a Negative Regulator to ?H2AX Ubiquitylation by RNF8/RNF168.
26381412 2015 ATDC (Ataxia Telangiectasia Group D Complementing) Promotes Radioresistance through an Interaction with the RNF8 Ubiquitin Ligase.
25955491 2015 RNF8 plays an important role in the radioresistance of human nasopharyngeal cancer cells in vitro.
25483088 2014 miR-214-mediated downregulation of RNF8 induces chromosomal instability in ovarian cancer cells.
25417706 2015 Rad18 and Rnf8 facilitate homologous recombination by two distinct mechanisms, promoting Rad51 focus formation and suppressing the toxic effect of nonhomologous end joining.
25416956 2014 A proteome-scale map of the human interactome network.
25374327 2015 Genetic association study of RNF8 and BRDT variants with non-obstructive azoospermia in the Chinese Han population.
25337968 2014 Regulation of 53BP1 protein stability by RNF8 and RNF168 is important for efficient DNA double-strand break repair.
More...