Property Summary

NCBI Gene PubMed Count 38
Grant Count 16
R01 Count 5
Funding $1,552,395.1
PubMed Score 85.33
PubTator Score 202.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26266980 SEC14L2 enabled RNA replication of diverse HCV genotypes in several human hepatoma cell lines
25290554 PI3Kgamma-induced VEGF expression was reduced when the human tocopherol-associated protein 1 (hTAP1/SEC14L2) was overexpressed suggesting formation of an inactive PI3Kgamma/hTAP1 heterodimer.
24983950 hTAP1 reduces the in vitro activity of the phosphatidylinositol-3-kinase gamma (PI3Kgamma) indicating the formation of a stalled/inactive hTAP1/PI3Kgamma heterodimer.
23411208 TAP expression was significantly correlated with Her2/neu receptor expression and breast cancer stage.
23401652 novel association between the rs737723 polymorphism (SEC14L2/TAP) and higher primary open-angle glaucoma risk
19909011 Fndings raise the possibility that TAP/Sec14L2 may serve as a tumor suppressor in breast carcinogenesis.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19305383 These findings are consistent with alpha-tocopherol-associated protein acting as an antiproliferative factor in estrogen-receptor-positive luminal cells in normal/benign breast tissue
19190344 Genetic variation in TTPA and SEC14L2 is associated with serum alpha-tocopherol but does not have a direct effect on prostate cancer when vitamin E is administered.
More...

AA Sequence

MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDN      1 - 70
IISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTT     71 - 140
KLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLS    141 - 210
EDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEH    211 - 280
SVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED    281 - 350
GTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPK                     351 - 403
//

Text Mined References (40)

PMID Year Title
26266980 2015 SEC14L2 enables pan-genotype HCV replication in cell culture.
25290554 2015 Induction of VEGF expression by alpha-tocopherol and alpha-tocopheryl phosphate via PI3K?/PKB and hTAP1/SEC14L2-mediated lipid exchange.
24983950 2014 Modulation of phosphorylation of tocopherol and phosphatidylinositol by hTAP1/SEC14L2-mediated lipid exchange.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23411208 2013 Alteration of ?-tocopherol-associated protein (TAP) expression in human breast epithelial cells during breast cancer development.
23401652 2013 Effects of polymorphisms in vitamin E-, vitamin C-, and glutathione peroxidase-related genes on serum biomarkers and associations with glaucoma.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
19909011 2009 Reduced expression of tocopherol-associated protein (TAP/Sec14L2) in human breast cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
More...