Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.11
PubTator Score 170.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Atrial Fibrillation 124 3.648 1.8

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.3e-03
Astrocytoma, Pilocytic -1.700 1.8e-05
atypical teratoid / rhabdoid tumor -1.900 3.6e-11
ependymoma -1.600 3.7e-09
glioblastoma -1.500 2.5e-06
lung carcinoma 2.500 2.0e-33
medulloblastoma, large-cell -1.300 8.2e-05
primitive neuroectodermal tumor -1.300 2.8e-05
sonic hedgehog group medulloblastoma -1.200 1.1e-02

Gene RIF (5)

AA Sequence

MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPATPLLFHPHTK      1 - 70
GSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPK     71 - 140
YACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLT    141 - 210
RGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAAGCPIPQNSLNS    211 - 280
QHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRSGGARP    281 - 350
GALSFGVTTCDPGTLRPADLPFSPEALVDRKEFWAVCRVPGPLHSGDILGLVVNADGELHLSHNGAAAGM    351 - 420
QLCVDASQPLWMLFGLHGTITQIRILGSTILAERGIPSLPCSPASTPTSPSALGSRLSDPLLSTCSSGPL    421 - 490
GSSAGGTAPNSPVSLPESPVTPGLGQWSDECTICYEHAVDTVIYTCGHMCLCYACGLRLKKALHACCPIC    491 - 560
RRPIKDIIKTYRSS                                                            561 - 574
//

Text Mined References (15)

PMID Year Title