Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.08
PubTator Score 170.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Colorectal Neoplasms 217
Disease Target Count P-value
lung carcinoma 2844 1.95593624216906E-33
atypical teratoid / rhabdoid tumor 4369 3.56173839977452E-11
ependymoma 2514 3.65522833825775E-9
glioblastoma 5572 2.01620588916442E-8
pilocytic astrocytoma 3086 1.2758756211549E-5
primitive neuroectodermal tumor 3031 2.83220322342525E-5
medulloblastoma, large-cell 6234 8.17505033282383E-5
adult high grade glioma 2148 0.00178172584811299
sonic hedgehog group medulloblastoma 1482 0.0114075485667248
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.900 0.000
ependymoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.300 0.000
adult high grade glioma -1.700 0.002
pilocytic astrocytoma -1.700 0.000
sonic hedgehog group medulloblastoma -1.200 0.011
lung carcinoma 2.500 0.000

Synonym

Accession O76050 Q5TDR2 Q5TDR3 Q8TAN0 Q9H463
Symbols neu
NEUR1
NEURL
RNF67
neu-1
bA416N2.1

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Fruitfly OMA Inparanoid

Gene RIF (4)

PMID Text
26276215 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
25124494 This is a novel gene implicated in atrial fibrillation
20847082 NEURL1 expression was downregulated in medulloblastoma compared to normal cerebellar tissue with lowest expression levels in hedgehog-activated tumors; conclude NEURL1 is candidate tumor suppressor in MB at least in part through effects on Notch pathway
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPATPLLFHPHTK      1 - 70
GSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPK     71 - 140
YACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLT    141 - 210
RGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAAGCPIPQNSLNS    211 - 280
QHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRSGGARP    281 - 350
GALSFGVTTCDPGTLRPADLPFSPEALVDRKEFWAVCRVPGPLHSGDILGLVVNADGELHLSHNGAAAGM    351 - 420
QLCVDASQPLWMLFGLHGTITQIRILGSTILAERGIPSLPCSPASTPTSPSALGSRLSDPLLSTCSSGPL    421 - 490
GSSAGGTAPNSPVSLPESPVTPGLGQWSDECTICYEHAVDTVIYTCGHMCLCYACGLRLKKALHACCPIC    491 - 560
RRPIKDIIKTYRSS                                                            561 - 574
//

Text Mined References (14)

PMID Year Title
26276215 2015 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
20847082 2010 Neuralized1 causes apoptosis and downregulates Notch target genes in medulloblastoma.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213446 2002 Dendritic localization of mammalian neuralized mRNA encoding a protein with transcription repression activities.
More...