Property Summary

NCBI Gene PubMed Count 14
Grant Count 13
R01 Count 6
Funding $1,165,744.5
PubMed Score 11.08
PubTator Score 170.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.900 0.000
ependymoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.300 0.000
adult high grade glioma -1.700 0.002
pilocytic astrocytoma -1.700 0.000
sonic hedgehog group medulloblastoma -1.200 0.011
lung carcinoma 2.500 0.000

Gene RIF (4)

PMID Text
26276215 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
25124494 This is a novel gene implicated in atrial fibrillation
20847082 NEURL1 expression was downregulated in medulloblastoma compared to normal cerebellar tissue with lowest expression levels in hedgehog-activated tumors; conclude NEURL1 is candidate tumor suppressor in MB at least in part through effects on Notch pathway
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPATPLLFHPHTK      1 - 70
GSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPK     71 - 140
YACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLT    141 - 210
RGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAAGCPIPQNSLNS    211 - 280
QHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRSGGARP    281 - 350
GALSFGVTTCDPGTLRPADLPFSPEALVDRKEFWAVCRVPGPLHSGDILGLVVNADGELHLSHNGAAAGM    351 - 420
QLCVDASQPLWMLFGLHGTITQIRILGSTILAERGIPSLPCSPASTPTSPSALGSRLSDPLLSTCSSGPL    421 - 490
GSSAGGTAPNSPVSLPESPVTPGLGQWSDECTICYEHAVDTVIYTCGHMCLCYACGLRLKKALHACCPIC    491 - 560
RRPIKDIIKTYRSS                                                            561 - 574
//

Text Mined References (14)

PMID Year Title
26276215 2015 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
25124494 2014 Integrating genetic, transcriptional, and functional analyses to identify 5 novel genes for atrial fibrillation.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
20847082 2010 Neuralized1 causes apoptosis and downregulates Notch target genes in medulloblastoma.
20526338 2010 Genome-wide meta-analyses identifies seven loci associated with platelet aggregation in response to agonists.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213446 2002 Dendritic localization of mammalian neuralized mRNA encoding a protein with transcription repression activities.
More...