Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.3e-05
diabetes mellitus 1728 1.1e-03

Synonym

Accession O76042 Q6NT35
Symbols Po42
C1orf1
C3orf51

Gene

 Compartment GO Term (0)

AA Sequence

MLACFPCFLRRKMPCLLKVADAGCSVGLGKVHCSCHLPNPRVLRHCDILTGVLTLGLDMSCHACLSAGTG      1 - 70
LGEELVGLGPGSTCLVKHLWLLFPCHRLASQNYSDSLAQQWSFSLLIMWLCNREREIFMSKCAKCI         71 - 136
//

Text Mined References (4)

PMID Year Title