Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
diabetes mellitus 1,663
ovarian cancer 8,484

Synonym

Accession O76042 Q6NT35
Symbols Po42
C1orf1
C3orf51

Gene

 Compartment GO Term (0)

AA Sequence

MLACFPCFLRRKMPCLLKVADAGCSVGLGKVHCSCHLPNPRVLRHCDILTGVLTLGLDMSCHACLSAGTG      1 - 70
LGEELVGLGPGSTCLVKHLWLLFPCHRLASQNYSDSLAQQWSFSLLIMWLCNREREIFMSKCAKCI         71 - 136
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9653645 1998 Molecular cloning and expression analysis of five novel genes in chromosome 1p36.