Property Summary

NCBI Gene PubMed Count 36
PubMed Score 31.39
PubTator Score 23.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Atrial Fibrillation 124 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Melanoma 711 0.0 0.7
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.8
Mental Depression 333 0.0 1.9
Vascular disease 319 0.0 1.4

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease 1.973 2.2e-03
active ulcerative colitis 1.919 4.6e-03
adult high grade glioma -1.800 6.9e-05
aldosterone-producing adenoma -1.318 2.3e-02
atypical teratoid / rhabdoid tumor -1.600 1.5e-02
Breast cancer -1.400 3.6e-06
colon cancer 3.700 3.9e-03
cutaneous lupus erythematosus -1.100 3.8e-02
cystic fibrosis -1.300 1.0e-04
Down syndrome 1.100 1.3e-03
Endometriosis -2.104 3.7e-02
ependymoma 1.400 2.1e-02
glioblastoma -2.100 1.6e-05
group 3 medulloblastoma -4.300 5.6e-10
interstitial cystitis -1.500 1.1e-02
intraductal papillary-mucinous adenoma (... 1.300 7.3e-03
intraductal papillary-mucinous carcinoma... 1.500 5.2e-03
intraductal papillary-mucinous neoplasm ... 1.600 2.2e-02
invasive ductal carcinoma 2.400 4.0e-02
lung adenocarcinoma -1.100 1.5e-08
lung cancer 1.800 2.2e-03
malignant mesothelioma -2.800 3.1e-08
medulloblastoma, large-cell -3.900 2.6e-06
nasopharyngeal carcinoma -1.600 9.7e-04
non-small cell lung cancer -2.141 1.8e-18
osteosarcoma -1.431 1.9e-02
ovarian cancer -2.000 3.7e-06
pancreatic cancer -1.500 5.3e-03
primary pancreatic ductal adenocarcinoma -1.410 2.8e-03
primitive neuroectodermal tumor -2.600 1.7e-03
progressive supranuclear palsy -1.100 5.3e-03
psoriasis -1.200 4.3e-04
spina bifida -2.436 3.7e-02

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MRVPVFEDIKDETEEEKIGEEENEEDQVFYKPVIEDLSMELARKCTELISDIRYKEEFKKSKDKCTFVTD      1 - 70
SPMLNHVKNIGAFISEAKYKGTIKADLSNSLYKRMPATIDSVFAGEVTQLQSEVAYKQKHDAAKGFSDYA     71 - 140
HMKEPPEVKHAMEVNKHQSNISYRKDVQDTHTYSAELDRPDIKMATQISKIISNAEYKKGQGIMNKEPAV    141 - 210
IGRPDFEHAVEASKLSSQIKYKEKFDNEMKDKKHHYNPLESASFRQNQLAATLASNVKYKKDIQNMHDPV    211 - 280
SDLPNLLFLDHVLKASKMLSGREYKKLFEENKGMYHFDADAVEHLHHKGNAVLQSQVKYKEEYEKNKGKP    281 - 350
MLEFVETPSYQASKEAQKMQSEKVYKEDFEKEIKGRSSLDLDKTPEFLHVKYITNLLREKEYKKDLENEI    351 - 420
KGKGMELNSEVLDIQRAKRASEMASEKEYKKDLESIIKGKGMQAGTDTLEMQHAKKAAEIASEKDYKRDL    421 - 490
ETEIKGKGMQVSTDTLDVQRAKKASEMASQKQYKKDLENEIKGKGMQVSMDIPDILRAKRTSEIYSQRKY    491 - 560
KDEAEKMLSNYSTIADTPEIQRIKTTQQNISAVFYKKEVGAGTAVKDSPEIERVKKNQQNISSVKYKEEI    561 - 630
KHATAISDPPELKRVKENQKNISNLQYKEQNYKATPVSMTPEIERVRRNQEQLSAVKYKGELQRGTAISD    631 - 700
PPELKRAKENQKNISNVYYRGQLGRATTLSVTPEMERVKKNQENISSVKYTQDHKQMKGRPSLILDTPAM    701 - 770
RHVKEAQNHISMVKYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVD    771 - 840
LKVWRTDPGSIFDLDPLEDNIQSRSLHMLSEKASHYRRHWSRSHSSSTFGTGLGDDRSEISEIYPSFSCC    841 - 910
SEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSPNLRTYRAMYDYSAQDEDEVSFRDGDY    911 - 980
IVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN                                        981 - 1014
//

Text Mined References (37)

PMID Year Title