Property Summary

NCBI Gene PubMed Count 21
PubMed Score 61.25
PubTator Score 17.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 GO Function (1)

Gene RIF (12)

AA Sequence

MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ      1 - 70
DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH     71 - 140
HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD    141 - 210
VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP        211 - 276
//

Text Mined References (21)

PMID Year Title