Property Summary

NCBI Gene PubMed Count 19
PubMed Score 53.18
PubTator Score 17.30

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O76038 A8K0B2 Q5VV44 Q96QV7 Q9UJF6
Symbols SEGN
CALBL
SECRET
setagin
DJ501N12.8

Gene

 GO Function (1)

Gene RIF (10)

PMID Text
25226615 These results suggest SCGN is involved in the chemoresistance of small cell lung cancer under the regulation of miR-494
23102406 Scgn is a CaBP expressed in a subpopulation of nociceptive DRG neurons and their processes in the dorsal horn.
22921511 While secretagogin mRNA was detected in both peripheral mononuclear cells and erythrocytes using reverse-transcription polymerase chain reaction, SCGN protein was only detected in erythrocytes.
22474393 Data show that the density of secretagogin-positive neurons selectively decreases in the olfactory tract in Alzheimer's disease.
21976236 Levels of secretagogin correlate with mortality and are useful as predictors of outcome in children with traumatic brain injury.
21288557 Ddetection of novel calcium-binding protein secretagogin within subgroup of clear-cell renal cell carcinomas. Increased metastasis rates within secretagogin-positive subgroup of clear-cell renal cell carcinomas.
20529129 Results emphasize the developmentally shared origins of neurons populating the extended amygdala, and suggest that secretagogin can be relevant to the generation of functional modalities in specific neuronal circuitries.
17083620 We identified and characterized promoter activity of a human 1498 bp secretagogin sequence upstream the transcription start site.
15766553 two new variants of the recently identified hexa-EF-hand calcium binding protein secretagogin
15237930 Secretagogin might play a role in human non-functional pituitary adenomas. This novel finding may provide clues to clarify the basic molecular mechanisms of pituitary adenoma formation, and to identify new tumor-related markers.

AA Sequence

MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ      1 - 70
DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH     71 - 140
HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD    141 - 210
VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP        211 - 276
//

Text Mined References (19)

PMID Year Title
25226615 2014 Overexpression of secretagogin inhibits cell apoptosis and induces chemoresistance in small cell lung cancer under the regulation of miR-494.
23102406 2012 Secretagogin is expressed in sensory CGRP neurons and in spinal cord of mouse and complements other calcium-binding proteins, with a note on rat and human.
22921511 2012 Detectability of secretagogin in human erythrocytes.
22474393 2012 Clusters of secretagogin-expressing neurons in the aged human olfactory tract lack terminal differentiation.
21976236 2012 The usefulness of S100B, NSE, GFAP, NF-H, secretagogin and Hsp70 as a predictive biomarker of outcome in children with traumatic brain injury.
21288557 2011 Expression of secretagogin in clear-cell renal cell carcinomas is associated with a high metastasis rate.
20529129 2010 Secretagogin is a Ca2+-binding protein identifying prospective extended amygdala neurons in the developing mammalian telencephalon.
19503597 2009 Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
17083620 2006 Identification and characterization of secretagogin promoter activity.
More...