Property Summary

NCBI Gene PubMed Count 21
PubMed Score 61.25
PubTator Score 17.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession O76038 A8K0B2 Q5VV44 Q96QV7 Q9UJF6
Symbols SEGN
CALBL
SECRET
setagin
DJ501N12.8

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (12)

AA Sequence

MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQ      1 - 70
DASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLH     71 - 140
HKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYD    141 - 210
VSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP        211 - 276
//

Text Mined References (21)

PMID Year Title