Property Summary

NCBI Gene PubMed Count 64
Grant Count 85
R01 Count 33
Funding $7,400,977.73
PubMed Score 245.88
PubTator Score 166.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.581 0.000
ovarian cancer 1.100 0.000

Synonym

Accession O76036 B0V3L2 B0V3L3 B0V3L4 B0V3L5 B8JL03 O76016 O76017 O76018
Symbols LY94
CD335
NKP46
NK-p46

Gene

PDB

1OLL   1P6F  

Gene RIF (56)

PMID Text
26714120 Intrahepatic NKp46 NK cells exhibited anti-HCV activity via cell-to-cell contact. The variation of the NKp46 proportion in individuals could be attributed to the diversity of HCV resistance observed in these individuals.
26554241 Expression of NKp46/NCR1 in NK cells was significantly higher in untreated severe aplastic anemia patients than those in remission SAA and controls. This may be the reason for the hyperfunction of the immune system in SAA patients.
26372382 Taken together, these results demonstrate that endogenous levels of IFN-alpha secreted by plasmacytoid dendritic cells induce natural killer cells to lyse HIV-1-infected autologous CD4+ primary T cells via the engagement of NKp46 and NKG2D.
26371250 Ncr1-Noe proteins accumulate in the endoplasmic reticulum, and that the expression of Ncr1-Noe proteins, but not WT Ncr1, leads to increased Helios expression
26232426 Data show that regulatory dendritic cells (regDC) restrain IFN-gamma secretion by NK cells through secretion of interleukin-10 (IL-10), engagement of MHC class I-specific inhibitory receptors, and the activating receptor NKp46.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25940096 NKp46 was thus involved in the production of serine proteases and interleukin-22 in human mast cells.
24824867 On CD56(+) CD3(-) cells, NKp44 and NKp46 expressions were high in the acute hepatitis E patients, whereas NKp30, NKp44, NKp46 and NKG2D were high in the recovered individuals.
24807109 Women, w/ or w/o endometriosis, having larger populations of cytotoxic CD16(+) uterine NK cells and/or higher populations of NKp46(+)CD56(+) cells may be at greater risk of infertility resulting from inflammatory environment during implantation or later
24769842 Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients.
More...

AA Sequence

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD      1 - 70
RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV     71 - 140
TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV    141 - 210
TGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSR    211 - 280
KRTRERASRASTWEGRRRLNTQTL                                                  281 - 304
//

Text Mined References (66)

PMID Year Title
26714120 2016 Functional Behavior of NKp46-Positive Intrahepatic Natural Killer Cells Against Hepatitis C Virus Reinfection After Liver Transplantation.
26554241 2015 Expression of NK-Activating Receptor-NKp46/NCR1 on NK Cells in Patients with Severe Aplastic Anemia.
26372382 2015 Lysis of HIV-1-infected autologous CD4+ primary T cells by interferon-alpha-activated NK cells requires NKp46 and NKG2D.
26371250 2015 Expression, Function, and Molecular Properties of the Killer Receptor Ncr1-Noé.
26232426 2015 Regulatory Dendritic Cells Restrain NK Cell IFN-? Production through Mechanisms Involving NKp46, IL-10, and MHC Class I-Specific Inhibitory Receptors.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25940096 2015 NKp46 regulates the production of serine proteases and IL-22 in human mast cells in urticaria pigmentosa.
24824867 2014 Increased expressions of NKp44, NKp46 on NK/NKT-like cells are associated with impaired cytolytic function in self-limiting hepatitis E infection.
24807109 2014 Characterization of uterine NK cells in women with infertility or recurrent pregnancy loss and associated endometriosis.
24769842 2014 Decreased expression of NKG2D, NKp46, DNAM-1 receptors, and intracellular perforin and STAT-1 effector molecules in NK cells and their dim and bright subsets in metastatic melanoma patients.
More...