Property Summary

NCBI Gene PubMed Count 69
PubMed Score 271.55
PubTator Score 166.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 8.0e-10
osteosarcoma 7950 2.9e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Influenza 142 4.112 2.1
Cancer 2499 4.084 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.581 2.9e-06
ovarian cancer 1.100 8.0e-10

Gene RIF (60)

AA Sequence

MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVD      1 - 70
RPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKV     71 - 140
TFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLV    141 - 210
TGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSR    211 - 280
KRTRERASRASTWEGRRRLNTQTL                                                  281 - 304
//

Text Mined References (71)

PMID Year Title