Property Summary

NCBI Gene PubMed Count 16
Grant Count 122
R01 Count 63
Funding $21,463,255.42
PubMed Score 196.10
PubTator Score 37.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
pancreatic cancer 1.200 0.015
Multiple myeloma 1.229 0.012
osteosarcoma -1.785 0.000
pancreatic ductal adenocarcinoma liver m... -1.495 0.001
tuberculosis and treatment for 6 months -1.500 0.000
lung cancer 1.400 0.001
Breast cancer 3.100 0.024
atypical teratoid/rhabdoid tumor 1.200 0.000
pancreatic carcinoma 1.200 0.015
lung adenocarcinoma -1.200 0.000
ovarian cancer 1.900 0.001

Synonym

Accession O76031 A1L428 A8K8F1 B9EGI8 Q9H4D9
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (7)

PMID Text
26142927 results illustrate that ClpX overexpression is a good and simple model to study the underlying mechanisms of the UPRmt in mammalian cells.
25083874 Optical trapping to assay single-molecule ClpXP unfolding and translocation of substrates consisting of domains with varying stabilities and sequences; find that ClpXP unfolds most domains by a single pathway, with kinetics that depend on the native fold and structural stability.
22841477 human ClpX, a novel mtDNA regulator, maintains mtDNA nucleoid distribution through TFAM function as a chaperone rather than as a protease and its involvement in mtDNA segregation.
22710082 Walker B mutation in human CLPX exhibits improved interaction with the model unfolded substrate casein and several putative physiological substrates in vitro.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18313382 Results reveal that the ssrA tag interacts with different loops that form the top, middle, and lower portions of the central channel of the ClpX hexamer.
16115876 hClpX can regulate the appearance of hClpP peptidase activity in mitochondria and might affect the nature of the degradation products released during ATP-dependent proteolytic cycles

AA Sequence

MPSCGACTCGAAAVRLITSSLASAQRGISGGRIHMSVLGRLGTFETQILQRAPLRSFTETPAYFASKDGI      1 - 70
SKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEA     71 - 140
DSKKSIIKEPESAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPANLR    141 - 210
QQAEVEKQTSLTPRELEIRRREDEYRFTKLLQIAGISPHGNALGASMQQQVNQQIPQEKRGGEVLDSSHD    211 - 280
DIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKA    281 - 350
QQGIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVAS    351 - 420
GAFNGLDRIISRRKNEKYLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLRHVEARDLIEF    421 - 490
GMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTG    491 - 560
ARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWPRQADA    561 - 630
ANS                                                                       631 - 633
//

Text Mined References (27)

PMID Year Title
26142927 2015 ClpX stimulates the mitochondrial unfolded protein response (UPRmt) in mammalian cells.
25957689 2015 Mitochondrial ClpX Activates a Key Enzyme for Heme Biosynthesis and Erythropoiesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25083874 2014 Stochastic but highly coordinated protein unfolding and translocation by the ClpXP proteolytic machine.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22841477 2012 Maintenance of mitochondrial genome distribution by mitochondrial AAA+ protein ClpX.
22710082 2012 Substrate recognition and processing by a Walker B mutant of the human mitochondrial AAA+ protein CLPX.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...