Property Summary

NCBI Gene PubMed Count 17
PubMed Score 211.18
PubTator Score 37.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 3.8e-05
Breast cancer 3.100 2.4e-02
hepatocellular carcinoma 1.100 1.4e-04
lung adenocarcinoma -1.200 3.2e-10
lung cancer 1.400 9.3e-04
Multiple myeloma 1.229 1.2e-02
osteosarcoma -1.785 1.4e-05
ovarian cancer 1.900 1.0e-03
pancreatic cancer 1.200 1.5e-02
pancreatic carcinoma 1.200 1.5e-02
pancreatic ductal adenocarcinoma liver m... -1.495 5.4e-04
tuberculosis and treatment for 3 months -1.100 9.9e-03

Gene RIF (8)

AA Sequence

MPSCGACTCGAAAVRLITSSLASAQRGISGGRIHMSVLGRLGTFETQILQRAPLRSFTETPAYFASKDGI      1 - 70
SKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVSSTRFVKCEKCHHFFVVLSEA     71 - 140
DSKKSIIKEPESAAEAVKLAFQQKPPPPPKKIYNYLDKYVVGQSFAKKVLSVAVYNHYKRIYNNIPANLR    141 - 210
QQAEVEKQTSLTPRELEIRRREDEYRFTKLLQIAGISPHGNALGASMQQQVNQQIPQEKRGGEVLDSSHD    211 - 280
DIKLEKSNILLLGPTGSGKTLLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKA    281 - 350
QQGIVFLDEVDKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVAS    351 - 420
GAFNGLDRIISRRKNEKYLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLRHVEARDLIEF    421 - 490
GMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCELNVTEDALKAIARLALERKTG    491 - 560
ARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEPGYIRAPTKESSEEEYDSGVEEEGWPRQADA    561 - 630
ANS                                                                       631 - 633
//

Text Mined References (28)

PMID Year Title