Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.87
PubTator Score 9.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
esophageal adenocarcinoma -2.000 0.021
psoriasis 1.300 0.001
Atopic dermatitis -1.600 0.000
intraductal papillary-mucinous adenoma (... -1.800 0.001
intraductal papillary-mucinous carcinoma... -1.200 0.009
colon cancer 2.600 0.040
lung cancer 2.500 0.001
breast carcinoma 1.300 0.000
interstitial cystitis -2.800 0.000
nasopharyngeal carcinoma -1.500 0.001
spina bifida -2.231 0.041
Breast cancer 1.400 0.009
ductal carcinoma in situ 1.800 0.030
ovarian cancer -2.400 0.000
pituitary cancer 1.400 0.002

Synonym

Accession O76027 Q5SZF1 Q6FI55 Q9BS00 Q9HBJ6
Symbols ANX31

Gene

Gene RIF (2)

PMID Text
22841549 Annexin A9 and periplakin co-localise in the epidermis and annexin A9 is up-regulated in differentiating keratinocytes, but the epidermal annexin A9 expression does not require periplakin.
12832069 examination of atypical properties

AA Sequence

MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTN      1 - 70
RSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEIL     71 - 140
ATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE    141 - 210
GPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLH    211 - 280
QALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM         281 - 345
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22841549 2012 Annexin A9 is a periplakin interacting partner in membrane-targeted cytoskeletal linker protein complexes.
21983785 2011 Genome-wide association study identifies a new melanoma susceptibility locus at 1q21.3.
21926416 2011 Genome-wide association study identifies novel loci predisposing to cutaneous melanoma.
20383146 2010 New loci associated with kidney function and chronic kidney disease.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...