Property Summary

NCBI Gene PubMed Count 22
Grant Count 11
R01 Count 2
Funding $1,929,932.71
PubMed Score 20.32
PubTator Score 10.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25749381 High CSIG promotes hepatocellular carcinoma proliferation by activating c-MYC expression.
18678645 CSIG acts as a novel regulatory component of replicative senescence, which requires PTEN as a mediator and involves in a translational regulatory mechanism.
18187620 Knockdown of ribosomal L1 domain containing 1 (RSL1D1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15880258 Our results suggest that PBK1 is involved in the regulation of uPA expression, which might provide a new clue to further understanding the regulation mechanism of uPA expression.

AA Sequence

MEDSASASLSSAAATGTSTSTPAAPTARKQLDKEQVRKAVDALLTHCKSRKNNYGLLLNENESLFLMVVL      1 - 70
WKIPSKELRVRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNKHGIKTVSQIISLQTLKKEYK     71 - 140
SYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNLLSKNLSREINDCIGGTVLNISKSGS    141 - 210
CSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIFSSFVSNWDEATKRSLL    211 - 280
NKKKKEARRKRRERNFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTVKKPESKKEQTPEHGKKKRGR    281 - 350
GKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAE    351 - 420
SETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKFFTTPSKSVRKASHTPKKWPKKPKVPQST    421 - 490
//

Text Mined References (40)

PMID Year Title
25749381 2015 CSIG promotes hepatocellular carcinoma proliferation by activating c-MYC expression.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22419112 2012 Nucleolar protein CSIG is required for p33ING1 function in UV-induced apoptosis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...