Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
Funding $161,871.75
PubMed Score 2.68
PubTator Score 15.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000

Synonym

Accession O76015 A2RRM5 Q6A164
Symbols HA8
hHa8
KRTHA8

Gene

Gene RIF (1)

PMID Text
15248378 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTSSYSSSSCPLGCTMAPGARNVSVSPIDIGCQPGAEANIAPMCLLANVAHANRVRVGSTPLGRPSLCLP      1 - 70
PTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERS     71 - 140
KCHESTVCPDYQSYFHTIEELQQKILCSKAENARLIVQIDNAKLAADDFRIKLESERSLRQLVEADKCGT    141 - 210
QKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILRSQLGEKLRIELDIEPTIDLNRVLGEMRAQY    211 - 280
EAMLETNRQDVEQWFQAQSEGISLQDMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCE    281 - 350
AEDRFGTELAQMQSLISNVEEQLSEIRADLERQNQEYQVLLDVKTRLENEIATYRNLLESEDCKLPCNPC    351 - 420
STSPSCVTAPCAPRPSCGPCTTCGPTCGASTTGSRF                                      421 - 456
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16831889 2006 New consensus nomenclature for mammalian keratins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15617563 2004 The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15248378 2004 Keratin 8 Y54H and G62C mutations are not associated with inflammatory bowel disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
More...