Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.03
PubTator Score 15.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 5.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Basal cell carcinoma 54 3.215 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.4e-05

Synonym

Accession O76015 A2RRM5 Q6A164
Symbols HA8
hHa8
KRTHA8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MTSSYSSSSCPLGCTMAPGARNVSVSPIDIGCQPGAEANIAPMCLLANVAHANRVRVGSTPLGRPSLCLP      1 - 70
PTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANYLEKVRQLEQENAELEATLLERS     71 - 140
KCHESTVCPDYQSYFHTIEELQQKILCSKAENARLIVQIDNAKLAADDFRIKLESERSLRQLVEADKCGT    141 - 210
QKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILRSQLGEKLRIELDIEPTIDLNRVLGEMRAQY    211 - 280
EAMLETNRQDVEQWFQAQSEGISLQDMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCE    281 - 350
AEDRFGTELAQMQSLISNVEEQLSEIRADLERQNQEYQVLLDVKTRLENEIATYRNLLESEDCKLPCNPC    351 - 420
STSPSCVTAPCAPRPSCGPCTTCGPTCGASTTGSRF                                      421 - 456
//

Text Mined References (13)

PMID Year Title