Property Summary

NCBI Gene PubMed Count 6
PubMed Score 35.54
PubTator Score 19.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.0e-55
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mucoepidermoid carcinoma 26 3.002 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.100 5.0e-55

Synonym

Accession O76014
Symbols HA7
K37
KRTHA7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTSFYSTSSCPLGCTMAPGARNVFVSPIDVGCQPVAEANAASMCLLANVAHANRVRVGSTPLGRPSLCLP      1 - 70
PTSHTACPLPGTCHIPGNIGICGAYGKNTLNGHEKETMKFLNDRLANYLEKVRQLEQENAELETTLLERS     71 - 140
KCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQIDNAKLAADDFRIKLESERSLHQLVEADKCGT    141 - 210
QKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILRSQLGEKFRIELDIEPTIDLNRVLGEMRAQY    211 - 280
EAMVETNHQDVEQWFQAQSEGISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCE    281 - 350
AEDRYGTELAQMQSLISNLEEQLSEIRADLERQNQEYQVLLDVKARLENEIATYRNLLESEDCKLPCNPC    351 - 420
STPASCTSCPSCGPVTGGSPSGHGASMGR                                             421 - 449
//

Text Mined References (6)

PMID Year Title