Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $127,040.34
PubMed Score 28.71
PubTator Score 19.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.100 0.000

Synonym

Accession O76014
Symbols HA7
K37
KRTHA7

Gene

 Grant Application (2)

AA Sequence

MTSFYSTSSCPLGCTMAPGARNVFVSPIDVGCQPVAEANAASMCLLANVAHANRVRVGSTPLGRPSLCLP      1 - 70
PTSHTACPLPGTCHIPGNIGICGAYGKNTLNGHEKETMKFLNDRLANYLEKVRQLEQENAELETTLLERS     71 - 140
KCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQIDNAKLAADDFRIKLESERSLHQLVEADKCGT    141 - 210
QKLLDDATLAKADLEAQQESLKEEQLSLKSNHEQEVKILRSQLGEKFRIELDIEPTIDLNRVLGEMRAQY    211 - 280
EAMVETNHQDVEQWFQAQSEGISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCE    281 - 350
AEDRYGTELAQMQSLISNLEEQLSEIRADLERQNQEYQVLLDVKARLENEIATYRNLLESEDCKLPCNPC    351 - 420
STPASCTSCPSCGPVTGGSPSGHGASMGR                                             421 - 449
//

Text Mined References (6)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16831889 2006 New consensus nomenclature for mammalian keratins.
15617563 2004 The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
7686952 1993 Human hair keratins.