Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.93
PubTator Score 21.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.05492171025271E-11

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 0.000

Synonym

Accession O76013 Q86XG4
Symbols HA6
hHa6
KRTHA6

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

AA Sequence

MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSARSGLSGLGSCLPGSYLSS      1 - 70
ECHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAELESRIQEWYEFQIPYICPDY     71 - 140
QSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADINGLRRILDELTLCK    141 - 210
ADLEAQVESLKEELMCLKKNHEEEVSVLRCQLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDV    211 - 280
EAWFNTQTEELNQQVVSSSEQLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQ    281 - 350
MQCLISNVEAQLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVP    351 - 420
SVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL                           421 - 467
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16831889 2006 New consensus nomenclature for mammalian keratins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
7979242 1994 Intermediate filaments: structure, dynamics, function, and disease.
7686952 1993 Human hair keratins.