Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.42
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
esophageal adenocarcinoma -1.200 0.018
psoriasis -2.700 0.013
Atopic dermatitis -1.400 0.005
lung cancer 1.200 0.010

Synonym

Accession O76009 B2RA87 Q6NTB9 Q6ZZB9
Symbols HA3I
K33A
Ha-3I
Krt1-3
hHa3-I
KRTHA3A

Gene

AA Sequence

MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASY      1 - 70
LEKVRQLERDNAELENLIRERSQQQEPLVCASYQSYFKTIEELQQKILCSKSENARLVVQIDNAKLASDD     71 - 140
FRTKYETELSLRQLVESDINGLRRILDELTLCRSDLEAQVESLKEELLCLKQNHEQEVNTLRCQLGDRLN    141 - 210
VEVDAAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVN    211 - 280
ALEIELQAQHNLRDSLENTLTESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE    281 - 350
CEINTYRSLLESEDCKLPSNPCATTNACDKSTGPCISNPCGLRARCGPCNTFGY                    351 - 404
//

Text Mined References (12)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15617563 2004 The human type I keratin gene family: characterization of new hair follicle specific members and evaluation of the chromosome 17q21.2 gene domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
More...