Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.42
PubTator Score 2.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 2.7e-05
Atopic dermatitis 952 4.9e-03
lung cancer 4740 1.0e-02
psoriasis 6694 1.3e-02
esophageal adenocarcinoma 737 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Lassa fever 9 5.478 2.7

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.400 4.9e-03
esophageal adenocarcinoma -1.200 1.8e-02
lung cancer 1.200 1.0e-02
malignant mesothelioma -1.400 2.7e-05
psoriasis -2.700 1.3e-02

Synonym

Accession O76009 B2RA87 Q6NTB9 Q6ZZB9
Symbols HA3I
K33A
Ha-3I
Krt1-3
hHa3-I
KRTHA3A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

AA Sequence

MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASY      1 - 70
LEKVRQLERDNAELENLIRERSQQQEPLVCASYQSYFKTIEELQQKILCSKSENARLVVQIDNAKLASDD     71 - 140
FRTKYETELSLRQLVESDINGLRRILDELTLCRSDLEAQVESLKEELLCLKQNHEQEVNTLRCQLGDRLN    141 - 210
VEVDAAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVN    211 - 280
ALEIELQAQHNLRDSLENTLTESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE    281 - 350
CEINTYRSLLESEDCKLPSNPCATTNACDKSTGPCISNPCGLRARCGPCNTFGY                    351 - 404
//

Text Mined References (12)

PMID Year Title