Property Summary

NCBI Gene PubMed Count 34
Grant Count 19
R01 Count 19
Funding $1,966,651.94
PubMed Score 85.03
PubTator Score 43.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis 1.400 0.000
osteosarcoma -1.458 0.000
non-small cell lung cancer 1.236 0.000
lung cancer 1.300 0.004
ovarian cancer 1.100 0.018

Gene RIF (16)

PMID Text
26613676 apo GRX3 and apo BOLA2 form a heterotrimeric complex, composed by two BOLA2 molecules and one GRX3 molecule
26302480 These findings provide an advanced view of the functional role of glutaredoxin-3 in iron metabolism.
26296460 These in vitro studies suggest that human GLRX3 is important for cytosolic Fe-S protein maturation.
25975981 findings provide novel insights into the regulation of Grx3, which is crucial for cell survival against environmental insults
23615448 Data indicate that silencing of Grx3 in HeLa cells decreases the activities of several cytosolic Fe/S proteins, including iron-regulatory protein 1, a major component of posttranscriptional iron regulation.
23415866 these data raise the possibility that the pro-apoptotic role of PICOT is actively regulated via caspase-3-mediated cleavage.
22309771 the unusual [2Fe-2S]-bridging Grx-BolA interaction is conserved in higher eukaryotes and may play a role in signaling cellular iron status in humans.
21575136 investigations into role of Grx3: Grx3-knockdown in HeLa cells leads to significant delay in mitotic exit and a higher percentage of binucleated cells.
21123948 analysis of primary breast cancer samples demonstrated that enhanced TXNL2 expression correlated with metastasis to the lung and brain and with decreased overall patient survival
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEA      1 - 70
EGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL     71 - 140
THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELI    141 - 210
GGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYET    211 - 280
FDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN                   281 - 335
//

Text Mined References (41)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26613676 2015 Elucidating the Molecular Function of Human BOLA2 in GRX3-Dependent Anamorsin Maturation Pathway.
26302480 2015 N-terminal domains mediate [2Fe-2S] cluster transfer from glutaredoxin-3 to anamorsin.
26296460 2015 Human glutaredoxin 3 can bind and effectively transfer [4Fe-4S] cluster to apo-iron regulatory protein 1.
25975981 2015 Nuclear glutaredoxin 3 is critical for protection against oxidative stress-induced cell death.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23615448 2013 Crucial function of vertebrate glutaredoxin 3 (PICOT) in iron homeostasis and hemoglobin maturation.
23415866 2013 Caspase-3-mediated cleavage of PICOT in apoptosis.
More...