Property Summary

NCBI Gene PubMed Count 39
PubMed Score 90.31
PubTator Score 43.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cardiomegaly 116 0.0 0.0
Disease Target Count P-value
non-small cell lung cancer 2890 1.2e-19
psoriasis 6694 3.6e-08
malignant mesothelioma 3232 6.0e-06
osteosarcoma 7950 4.5e-05
lung cancer 4740 4.2e-03
ovarian cancer 8520 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.300 4.2e-03
malignant mesothelioma 1.500 6.0e-06
non-small cell lung cancer 1.236 1.2e-19
osteosarcoma -1.458 4.5e-05
ovarian cancer 1.100 1.8e-02
psoriasis 1.200 3.6e-08

Protein-protein Interaction (4)

Gene RIF (18)

AA Sequence

MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEA      1 - 70
EGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL     71 - 140
THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELI    141 - 210
GGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYET    211 - 280
FDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN                   281 - 335
//

Text Mined References (46)

PMID Year Title