Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 45.81

Knowledge Summary

Patent (110)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Irritant dermatitis 9 4.176 2.1

Gene RIF (1)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMYFFLTNLSILD      1 - 70
LCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSFDRYVAVCRPLHYVVIMNYWF     71 - 140
CLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCEVPALLKLSCADTKPIEAELFFFSVLILLIP    141 - 210
VTLILISYGFIAQAVLKIRSAEGRQKAFGTCGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGI    211 - 280
ITSMLNSLIYSLRNKDMKEAFKRLMPRIFFCKK                                         281 - 313
//

Text Mined References (8)

PMID Year Title
24047820 2013 Common variation contributes to the genetic architecture of social communication traits.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18040051 2007 Distinguishing protein-coding and noncoding genes in the human genome.
14983052 2004 The human olfactory receptor gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12637542 2003 Complex transcription and splicing of odorant receptor genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.