Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.08
PubTator Score 16.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.8e-46

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.8e-46

AA Sequence

MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGK      1 - 70
KLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDSPGPEKMALAFSEQEEHELPV     71 - 140
LSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARVHTDFTPSPYDHDSLKLQKGDVIQIIEKPPV    141 - 210
GTWLGLLNGKVGSFKFIYVDVLPEEAVGHARPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQT    211 - 280
LEDFKELRETHLNELNIMDPQHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSG    281 - 350
CFEGSESGRDDAELAGTEEQLQGLSLAGAP                                            351 - 380
//

Text Mined References (11)

PMID Year Title