Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.20
PubTator Score 265.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pilocytic astrocytoma 3086 1.92987845087531E-9
osteosarcoma 7933 2.0548588074466E-5
astrocytic glioma 2241 5.72802535347534E-4
posterior fossa group A ependymoma 1511 7.48747252491728E-4
pituitary cancer 1972 0.0010135574617261
oligodendroglioma 2849 0.00287988060432504
glioblastoma 5572 0.00592760624147042
pediatric high grade glioma 2712 0.00881414130082633
group 3 medulloblastoma 2254 0.0453636160495245

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.200 0.001
oligodendroglioma 2.000 0.003
osteosarcoma 1.762 0.000
glioblastoma 1.800 0.006
pediatric high grade glioma 1.700 0.009
group 3 medulloblastoma -1.200 0.045
pilocytic astrocytoma 3.500 0.000
posterior fossa group A ependymoma 1.100 0.001
pituitary cancer 1.100 0.001

Synonym

Accession O75973
Symbols CRF
C1QRF
C1QTNF14

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19275900 Conserved recoding RNA editing of vertebrate C1q-related factor C1QL1.

AA Sequence

MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQG      1 - 70
KPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPH     71 - 140
EGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDAD    141 - 210
QNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD                          211 - 258
//

Text Mined References (7)

PMID Year Title
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19666007 2009 CTRP8 and CTRP9B are novel proteins that hetero-oligomerize with C1q/TNF family members.
19275900 2009 Conserved recoding RNA editing of vertebrate C1q-related factor C1QL1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9878755 1999 Cloning and characterization of CRF, a novel C1q-related factor, expressed in areas of the brain involved in motor function.