Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.97
PubTator Score 265.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.700 1.1e-02
astrocytic glioma 2.200 5.7e-04
Astrocytoma, Pilocytic 3.400 1.3e-09
glioblastoma 1.100 3.6e-02
group 3 medulloblastoma -1.200 4.5e-02
oligodendroglioma 2.000 2.9e-03
osteosarcoma 1.762 2.1e-05
pituitary cancer 1.100 1.0e-03
posterior fossa group A ependymoma 1.100 7.5e-04

Synonym

Accession O75973
Symbols CRF
C1QRF
C1QTNF14

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQG      1 - 70
KPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPH     71 - 140
EGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDAD    141 - 210
QNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD                          211 - 258
//

Text Mined References (7)

PMID Year Title