Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.20
PubTator Score 265.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 2.200 0.001
oligodendroglioma 2.000 0.003
osteosarcoma 1.762 0.000
glioblastoma 1.800 0.006
pediatric high grade glioma 1.700 0.009
group 3 medulloblastoma -1.200 0.045
pilocytic astrocytoma 3.500 0.000
posterior fossa group A ependymoma 1.100 0.001
pituitary cancer 1.100 0.001

Gene RIF (2)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19275900 Conserved recoding RNA editing of vertebrate C1q-related factor C1QL1.

AA Sequence

MLLVLVVLIPVLVSSGGPEGHYEMLGTCRMVCDPYPARGPGAGARTDGGDALSEQSGAPPPSTLVQGPQG      1 - 70
KPGRTGKPGPPGPPGDPGPPGPVGPPGEKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPH     71 - 140
EGYEVLKFDDVVTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDAD    141 - 210
QNYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD                          211 - 258
//

Text Mined References (7)

PMID Year Title
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19666007 2009 CTRP8 and CTRP9B are novel proteins that hetero-oligomerize with C1q/TNF family members.
19275900 2009 Conserved recoding RNA editing of vertebrate C1q-related factor C1QL1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9878755 1999 Cloning and characterization of CRF, a novel C1q-related factor, expressed in areas of the brain involved in motor function.