Property Summary

NCBI Gene PubMed Count 20
Grant Count 14
R01 Count 9
Funding $1,581,554.94
PubMed Score 24.42
PubTator Score 23.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

 GO Function (1)

Gene RIF (7)

PMID Text
26458542 AKAP3 correlates with triple negative status and disease free survival in breast cancer.
22941507 study reports the isolation of AKAP3 and CTp11 Cancer/testis antigens from hepatocellular carcinoma patient sera
21240291 CABYR variants form a complex not only with the scaffolding protein AKAP3 but also with another RII-like domain-containing protein in the sperm fibrous sheath.
17683036 AKAP3 is a novel target for protein S-nitrosylation in spermatozoa.
16005946 AKAP-3 demonstrates tumor-restricted expression and appears to be associated with worse overall survival.
14618620 In Cox multivariate analysis, AKAP3 mRNA expression was found to be a significant predictor of both overall and progression-free survival in patients with poorly differentiated tumors.
12509440 evidence of tyrosine phosphorylation during sperm capacitation

AA Sequence

MSEKVDWLQSQNGVCKVDVYSPGDNQAQDWKMDTSTDPVRVLSWLRRDLEKSTAEFQDVRFKPGESFGGE      1 - 70
TSNSGDPHKGFSVDYYNTTTKGTPERLHFEMTHKEIPCQGPRAQLGNGSSVDEVSFYANRLTNLVIAMAR     71 - 140
KEINEKIDGSENKCVYQSLYMGNEPTPTKSLSKIASELVNETVSACSRNAAPDKAPGSGDRVSGSSQSPP    141 - 210
NLKYKSTLKIKESTKERQGPDDKPPSKKSFFYKEVFESRNGDYAREGGRFFPRERKRFRGQERPDDFTAS    211 - 280
VSEGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLLKHAKEVVSDLIDSFLRNLHSVTGTLMT    281 - 350
DTQFVSAVKRTVFSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNV    351 - 420
NFAMKSETKLREKMYSEPKSEEETCAKTLGEHIIKEGLTLWHKTQQKECKSLGFQHAAFEAPNTQRKPAS    421 - 490
DISFEYPEDIGNLSLPPYPPEKPENFMYDSDSWAEDLIVSALLLIQYHLAQGGRRDARSFVEAAGTTNFP    491 - 560
ANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCE    561 - 630
RPLASSPPRLYEDDETPGALSGLTKMAVSQIDGHMSGQMVEHLMNSVMKLCVIIAKSCDASLAELGDDKS    631 - 700
GDASRLTSAFPDSLYECLPAKGTGSAEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQN    701 - 770
KQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNV    771 - 840
TPLQLLDWLMVNL                                                             841 - 853
//

Text Mined References (24)

PMID Year Title
26458542 2015 AKAP3 correlates with triple negative status and disease free survival in breast cancer.
25820252 2015 Interactome of the negative regulator of nuclear import BRCA1-binding protein 2.
22941507 2012 Identification of the cancer/testis antigens AKAP3 and CTp11 by SEREX in hepatocellular carcinoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21240291 2011 CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
17683036 2007 Human spermatozoa contain multiple targets for protein S-nitrosylation: an alternative mechanism of the modulation of sperm function by nitric oxide?
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...