Property Summary

NCBI Gene PubMed Count 22
PubMed Score 1.15
PubTator Score 0.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.800 6.9e-03
glioblastoma -1.500 7.2e-05
group 4 medulloblastoma -1.200 1.1e-03
inflammatory breast cancer -1.200 5.6e-04
malignant mesothelioma 1.200 4.2e-06
medulloblastoma, large-cell -1.100 1.2e-04
Multiple myeloma 1.770 1.4e-03
oligodendroglioma -1.500 2.3e-02
ovarian cancer -1.200 4.3e-04
pancreatic ductal adenocarcinoma liver m... -1.113 4.6e-02

Gene RIF (4)

AA Sequence

MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTV      1 - 70
KEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV                                          71 - 103
//

Text Mined References (28)

PMID Year Title