Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.98
PubTator Score 0.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.770 0.001
malignant mesothelioma 1.200 0.000
astrocytic glioma -1.800 0.007
oligodendroglioma -1.500 0.023
glioblastoma -1.500 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.113 0.046
inflammatory breast cancer -1.200 0.001
ovarian cancer -1.500 0.000

Synonym

Accession O75964 A8K0K3 Q96BV6 Q9UBZ7 ATPase subunit g
Symbols ATP5JG

Gene

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTV      1 - 70
KEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV                                          71 - 103
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
More...