Property Summary

NCBI Gene PubMed Count 39
PubMed Score 99.86
PubTator Score 188.08

Knowledge Summary

Patent (37,881)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
osteosarcoma 7933 1.01931609857299E-8
ovarian cancer 8492 1.8624719464762E-6
malignant mesothelioma 3163 3.74796232252235E-5
chronic lymphocytic leukemia 244 1.92174960929602E-4
Pick disease 1893 2.54742570177674E-4
pilocytic astrocytoma 3086 3.15304921061351E-4
oligodendroglioma 2849 0.00226506443927595
group 4 medulloblastoma 1875 0.00279404875222732
glioblastoma 5572 0.00508999017183154
psoriasis 6685 0.0073197226925146
gastric carcinoma 832 0.00879877896423847
pediatric high grade glioma 2712 0.00989292624608521
primary pancreatic ductal adenocarcinoma 1271 0.0114023197084087
pancreatic cancer 2300 0.0122487757685479
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0197726534210552
astrocytic glioma 2241 0.0238648846587433
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
chronic lymphocytic leukemia -1.222 0.000
malignant mesothelioma 1.100 0.000
astrocytic glioma 1.300 0.024
oligodendroglioma 1.300 0.002
psoriasis 1.200 0.007
glioblastoma 1.600 0.005
osteosarcoma 3.698 0.000
primary pancreatic ductal adenocarcinoma 1.085 0.011
intraductal papillary-mucinous carcinoma... 1.100 0.020
pediatric high grade glioma 1.100 0.010
group 4 medulloblastoma 1.500 0.003
pilocytic astrocytoma 1.300 0.000
Pick disease 1.300 0.000
gastric carcinoma 1.400 0.009
ovarian cancer 1.400 0.000
pancreatic cancer 1.300 0.012

Synonym

Accession O75962 D3DTD1 Q13458 Q59EQ7 Q6PJC9 Q6ZN05 Q8IWK8
Symbols tgat
MEBAS
MRD44
ARHGEF23

Gene

PDB

2NZ8   1NTY  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (22)

PMID Text
26235986 Strong statistical evidence for a causal role of TRIO in neurodevelopmental and neuropsychiatric disorders.
26116572 our data show the importance of spatio-temporal regulation of the actin cytoskeleton through Trio and Rac1 at VE-cadherin-based cell-cell junctions in the maintenance of the endothelial barrier.
25851347 Aberrant expression of TRIO might play an important role in hepatocellular carcinoma (HCC) through promoting cell proliferation and invasion, and TRIO may be a novel therapeutic target for the treatment of HCC
25355950 TRIO controls Rac1 activation in dividing cells which counteracts MgcRacGAP function in cytokinesis.
25065758 The +TIP Navigator 1 (NAV1) is important for neurite outgrowth and interacts and colocalizes with TRIO, a Rho guanine nucleotide exchange factor that enables neurite outgrowth by activating the Rho GTPases Rac1 and RhoG.
25065758 TRIO is an EB1 dependent MT plus end tracking protein, and forms a complex with NAV1 at growing MT ends, which regulates TRIO-mediated Rac1 activation and neurite outgrowth.
24859002 Describe here an invadopodia disassembly model, where a signalling axis involving TrioGEF, Rac1, Pak1, and phosphorylation of cortactin, causes invadopodia dissolution.
23177739 Trio, is essential for activating Rho- and Rac-regulated signaling pathways acting on JNK and p38.
22696684 We conclude that Trio promotes leukocyte transendothelial migration by inducing endothelial docking structure formation in a filamin-dependent manner through the activation of Rac1 and RhoG.
22238672 GEF Trio is responsible for lamellipodia formation through its N-terminal DH-PH domain in a Rac1-dependent manner during fibronectin-mediated spreading and migration.
More...

AA Sequence

MSGSSGGAAAPAASSGPAAAASAAGSGCGGGAGEGAEEAAKDLADIAAFFRSGFRKNDEMKAMDVLPILK      1 - 70
EKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVCKRGFTVIVDMRGSKWDSIKP     71 - 140
LLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNH    141 - 210
EEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQ    211 - 280
KLLQRIQSSESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAE    281 - 350
KMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIR    351 - 420
QIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQDLEDAIHHHQGI    421 - 490
YEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKV    491 - 560
RLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEA    561 - 630
AEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYA    631 - 700
ESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQ    701 - 770
MEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMNN    771 - 840
LTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHRKHLEQCVQLR    841 - 910
HLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHY    911 - 980
DMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPN    981 - 1050
SETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRE   1051 - 1120
NRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAK   1121 - 1190
QTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ   1191 - 1260
LDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLWEMTSGVEEIP   1261 - 1330
PGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEH   1331 - 1400
AGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHL   1401 - 1470
SMLEGFDENIESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTS   1471 - 1540
ELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKT   1541 - 1610
APATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRG   1611 - 1680
QTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSVSSNDASPPASV   1681 - 1750
ASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDD   1751 - 1820
SAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKA   1821 - 1890
SSRLLVRPTSSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEME   1891 - 1960
ERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFF   1961 - 2030
LGELEKCLEDPEKLGSLFVKHERRLHMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKP   2031 - 2100
VQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGKIVAQGKLLLQDTF   2101 - 2170
LVTDQDAGLLPRCRERRIFLFEQIVIFSEPLDKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFALTS   2171 - 2240
RTGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNALTSPIEYQRNHSGGGGGGGSGGSGGGGGSGG   2241 - 2310
GGAPSGGSGHSGGPSSCGGAPSTSRSRPSRIPQPVRHHPPVLVSSAASSQAEADKMSGTSTPGPSLPPPG   2311 - 2380
AAPEAGPSAPSRRPPGADAEGSEREAEPIPKMKVLESPRKGAANASGSSPDAPAKDARASLGTLPLGKPR   2381 - 2450
AGAASPLNSPLSSAVPSLGKEPFPPSSPLQKGGSFWSSIPASPASRPGSFTFPGDSDSLQRQTPRHAAPG   2451 - 2520
KDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFL   2521 - 2590
VFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYR   2591 - 2660
KSREGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTLNNDG   2661 - 2730
HYSISYSDLGEATLKIVGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGMDGIMVTWKDNFDSFYSEVA   2731 - 2800
ELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQSLQHPLLVGLLDTFETPTSYILVLE   2801 - 2870
MADQGRLLDCVVRWGSLTEGKIRAHLGEVLEAVRYLHNCRIAHLDLKPENILVDESLAKPTIKLADFGDA   2871 - 2940
VQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLLSGVSPFLDDSVEETCLNICRLDFS   2941 - 3010
FPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQAGNGRSTGVLDTSRLTSFIERRKHQNDVR   3011 - 3080
PIRSIKNFLQSRLLPRV                                                        3081 - 3097
//

Text Mined References (48)

PMID Year Title
26235986 2015 Incorporating Functional Information in Tests of Excess De Novo Mutational Load.
26116572 2015 A local VE-cadherin and Trio-based signaling complex stabilizes endothelial junctions through Rac1.
25851347 2015 Upregulated TRIO expression correlates with a malignant phenotype in human hepatocellular carcinoma.
25355950 2014 Identification of a mitotic Rac-GEF, Trio, that counteracts MgcRacGAP function during cytokinesis.
25065758 2014 Dynamic microtubules catalyze formation of navigator-TRIO complexes to regulate neurite extension.
24859002 2014 A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23776197 2013 Genome-wide association study identifies ephrin type A receptors implicated in paclitaxel induced peripheral sensory neuropathy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23177739 2013 A genome-wide RNAi screen reveals a Trio-regulated Rho GTPase circuitry transducing mitogenic signals initiated by G protein-coupled receptors.
More...