Property Summary

NCBI Gene PubMed Count 7
Grant Count 85
R01 Count 39
Funding $17,494,630.72
PubMed Score 7.79
PubTator Score 3.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
osteosarcoma -1.439 0.000
adrenocortical carcinoma -1.647 0.000
non primary Sjogren syndrome sicca 1.400 0.019
pituitary cancer -1.200 0.000

Synonym

Accession O75956 CDK2-associated protein 2
Symbols p14
DOC-1R

Gene

PDB

2M1L  

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
25675191 Our findings suggest that alteration of p16, p14, p27, p21, and p53 status may contribute to carcinogenesis and the clinical behavior of HPV-negative adenocarcinoma of the uterine cervix
23781148 antitumor effects of DOC-1R may be mediated by negatively regulating G1 phase progression and G1/S transition through inhibiting CDK2 expression and activation

AA Sequence

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS      1 - 70
QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART                   71 - 126
//

Text Mined References (7)

PMID Year Title
25675191 2015 Dysregulation of CDK inhibitors and p53 in HPV-negative endocervical adenocarcinoma.
23781148 2013 Overexpression of DOC-1R inhibits cell cycle G1/S transition by repressing CDK2 expression and activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985111 2004 Interaction of the CDK2-associated protein-1, p12(DOC-1/CDK2AP1), with its homolog, p14(DOC-1R).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10082655 1999 Identification and mutation analysis of DOC-1R, a DOC-1 growth suppressor-related gene.