Property Summary

NCBI Gene PubMed Count 93
PubMed Score 128.77
PubTator Score 105.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Q fever 15 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.4e-05
medulloblastoma, large-cell 6241 2.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 2.3e-04
ovarian cancer 1.500 6.4e-05

Gene RIF (58)

AA Sequence

MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ      1 - 70
VKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLV     71 - 140
NMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMA    141 - 210
KAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELE    211 - 280
ARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQE    281 - 350
AAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN    351 - 420
HKPLRTA                                                                   421 - 427
//

Text Mined References (102)

PMID Year Title