Property Summary

NCBI Gene PubMed Count 90
Grant Count 31
R01 Count 16
Funding $2,610,966.36
PubMed Score 121.05
PubTator Score 105.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 0.000
ovarian cancer 1.800 0.000

Gene RIF (57)

PMID Text
26682635 Flotillin-1 protein is upregulated in human endometrial cancer and localization shifts from epithelial to stromal with increasing tumor grade
26646322 Upregulation of flotillin-1 promotes invasion and metastasis by activating TGF-beta signaling in nasopharyngeal carcinoma.
26413934 Expression of flotillin-1 was associated with H-Ras in breast cancer, especially in TNBC (p < 0.001).
25948494 findings revealed the expression of flotillin 1 in gastric cancer samples is significantly higher than that of noncancer/normal tissues; findings suggest that flotillin 1 may be a novel biomarker for gastric cancer
25793370 miR-506 expression was down-regulated in clear cell renal cell carcinoma (ccRCC) and correlated with advanced histologic grade, clinical stage, tumor stage, positive lymph node metastasis, and distant metastasis. FLOT1, a potential target gene of miR-506, was inversely correlated with miR-506 expression in ccRCC tissues.
25180832 polycystins are necessary for assembly of a novel flotillin-containing ciliary signaling complex and provide a molecular rationale for the common renal pathologies caused by OFD1 and polycystin mutations.
24983503 a critical role of flotillin-1 in ROS production mediated by c-Src
24890092 Findings suggest that FLOT1 plays an important role in the proliferation and recurrence of transitional cell carcinoma.
24886554 Downregulation of microRNA-182-5p contributes to renal cell carcinoma proliferation via activating the AKT/FOXO3a signaling pathway with FLOT1 being a target.
24830726 Flotillin-1 regulates oncogenic signaling in neuroblastoma cells by regulating ALK membrane association.
More...

AA Sequence

MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ      1 - 70
VKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLV     71 - 140
NMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMA    141 - 210
KAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELE    211 - 280
ARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQE    281 - 350
AAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN    351 - 420
HKPLRTA                                                                   421 - 427
//

Text Mined References (99)

PMID Year Title
26682635 2016 Flotillin-1 protein is upregulated in human endometrial cancer and localization shifts from epithelial to stromal with increasing tumor grade.
26646322 2016 Upregulation of flotillin-1 promotes invasion and metastasis by activating TGF-? signaling in nasopharyngeal carcinoma.
26413934 2016 A novel role for flotillin-1 in H-Ras-regulated breast cancer aggressiveness.
25948494 2015 Plasma membrane proteomic analysis of human Gastric Cancer tissues: revealing flotillin 1 as a marker for Gastric Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25793370 2015 MiR-506 is down-regulated in clear cell renal cell carcinoma and inhibits cell growth and metastasis via targeting FLOT1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25180832 2014 OFD1 and flotillins are integral components of a ciliary signaling protein complex organized by polycystins in renal epithelia and odontoblasts.
More...