Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.55
PubTator Score 8.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.200 0.000
cystic fibrosis -1.193 0.000
medulloblastoma, large-cell 1.500 0.012
group 4 medulloblastoma 1.400 0.003

Synonym

Accession O75954 D3DUQ7 Q53FV2 Q6FGJ8 Tspan-9
Symbols NET5
NET-5
PP1057

Gene

Gene RIF (6)

PMID Text
26865714 TSPAN9 is an endosomal tetraspanin whose depletion has a pronounced effect on the entry of several viruses that fuse in the early endosome.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
18799160 tetraspanin CD9 has a role in determining vascular smooth muscle cell injury phenotypes
18795891 Findings suggest a role for Tspan9 in regulating platelet function in concert with other platelet tetraspanins and their associated proteins.

AA Sequence

MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFL      1 - 70
GCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNI     71 - 140
IQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGM    141 - 210
CILIMQILGMAFSMTLFQHIHRTGKKYDA                                             211 - 239
//

Text Mined References (17)

PMID Year Title
26865714 2016 Role of TSPAN9 in Alphavirus Entry and Early Endosomes.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23746317 2014 Genome-wide association study of degenerative bony changes of the temporomandibular joint.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18799160 2009 Functional relevance of tetraspanin CD9 in vascular smooth muscle cell injury phenotypes: a novel target for the prevention of neointimal hyperplasia.
18795891 2009 Identification of Tspan9 as a novel platelet tetraspanin and the collagen receptor GPVI as a component of tetraspanin microdomains.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
More...