Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.17
PubTator Score 8.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
cystic fibrosis 1696 7.4e-05
psoriasis 6694 2.0e-04
medulloblastoma, large-cell 6241 1.2e-02
group 3 medulloblastoma 4104 4.7e-02
Disease Target Count Z-score Confidence
Fallopian tube carcinoma 2 4.875 2.4
Apraxia 26 3.193 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.193 7.4e-05
group 3 medulloblastoma 1.200 4.7e-02
medulloblastoma, large-cell 1.500 1.2e-02
psoriasis 1.200 2.0e-04

Synonym

Accession O75954 D3DUQ7 Q53FV2 Q6FGJ8 Tspan-9
Symbols NET5
NET-5
PP1057

Gene

  Ortholog (1)

Species Source Disease
Macaque EggNOG Inparanoid

Gene RIF (7)

AA Sequence

MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFL      1 - 70
GCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNI     71 - 140
IQAEMRCCGVTDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGM    141 - 210
CILIMQILGMAFSMTLFQHIHRTGKKYDA                                             211 - 239
//

Text Mined References (18)

PMID Year Title