Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.78
PubTator Score 1.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy -1.433 8.0e-05
colon cancer -1.700 2.4e-06
Duchenne muscular dystrophy -1.128 3.0e-05
intraductal papillary-mucinous carcinoma... -1.100 3.0e-04
malignant mesothelioma 1.500 1.2e-05
oligodendroglioma 1.200 1.8e-02
osteosarcoma 1.234 1.5e-03
tuberculosis -1.400 8.3e-07

Synonym

Accession O75953 B3KN14 B4DSA6 J3KQM9 J3KR08 Q5T656 Q8TDR7 Q96EM4
Symbols Hsc40

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEE      1 - 70
GLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGA     71 - 140
FGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKI    141 - 210
LHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNI    211 - 280
PTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS      281 - 348
//

Text Mined References (17)

PMID Year Title