Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 6
Funding $611,144.67
PubMed Score 1.64
PubTator Score 1.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
oligodendroglioma 1.200 0.018
osteosarcoma 1.234 0.002
Duchenne muscular dystrophy -1.128 0.000
acute quadriplegic myopathy -1.433 0.000
tuberculosis -1.500 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.000
colon cancer -1.700 0.000

AA Sequence

MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEE      1 - 70
GLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGA     71 - 140
FGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKI    141 - 210
LHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNI    211 - 280
PTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS      281 - 348
//

Text Mined References (12)

PMID Year Title
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
22810586 2012 Interpreting cancer genomes using systematic host network perturbations by tumour virus proteins.
21231916 2011 The diverse members of the mammalian HSP70 machine show distinct chaperone-like activities.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
18457437 2008 Identification of intracellular proteins associated with the EBV-encoded nuclear antigen 5 using an efficient TAP procedure and FT-ICR mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11147971 2000 Mammalian HSP40/DNAJ homologs: cloning of novel cDNAs and a proposal for their classification and nomenclature.
More...