Property Summary

NCBI Gene PubMed Count 22
Grant Count 3
Funding $1,000,674.57
PubMed Score 20.14
PubTator Score 20.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -4.100 0.000
astrocytic glioma -1.200 0.002
ependymoma -1.400 0.004
oligodendroglioma -1.300 0.004
psoriasis -1.700 0.000
osteosarcoma -1.433 0.001
non-small cell lung cancer 1.653 0.000
lung cancer 2.800 0.002
lung adenocarcinoma 1.300 0.000
group 3 medulloblastoma -1.200 0.011
lung carcinoma 1.100 0.000
ovarian cancer 1.300 0.000
pituitary cancer -1.900 0.000
head and neck cancer and chronic obstruc... -1.400 0.009

Synonym

Accession O75952 B2R857 Q8WXW5 Q9HAY3 Q9HAY4 Q9HAY5 Q9HCY9
Symbols CT88
FSP2
CBP86
FSP-2
CABYRa
CABYRc
CABYRe
CABYRc/d

Gene

Gene RIF (9)

PMID Text
24362251 Short hairpin RNA-mediated knockdown of CABYR-a/b significantly inhibited the proliferation of NCI-H460 and A549 cells and resulted in the attenuation of Akt phosphorylation, which is constitutively active in lung cancer cells.
22285430 CABYR-c is highly expressed in hepatocellular carcinoma tissues and may play an oncogenic role in heptocarcinogenesis as well as its progression.
21274509 High CABYR is associated with neoplasms.
21240291 CABYR variants form a complex not only with the scaffolding protein AKAP3 but also with another RII-like domain-containing protein in the sperm fibrous sheath.
20954286 The expression of NF-kappaB was not significantly affected by silencing CABYR in 293T cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16139264 splice variants containing CR-B are expressed during spermiogenesis and assemble into the fibrous sheath of the principal piece; however, calcium binding occurs only to those CABYR isoforms containing CABYR-A
15752768 Northern blot showed that CABYR transcripts were expressed more distinctly in the fetal brain than in the adult brain, suggesting that this protein may play a role during brain development.
11820818 sequencing, cloning, expression and characterization

AA Sequence

MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKW      1 - 70
SEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGL     71 - 140
SSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLGKVSSIHSDQSDVLMVDVATSMPVVIKEVP    141 - 210
SSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVT    211 - 280
LQADIEVMSTVHISSVYNDVPVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEK    281 - 350
TTSGMSKKSVESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE    351 - 420
VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLTAPEIEPEGES    421 - 490
TAE                                                                       491 - 493
//

Text Mined References (24)

PMID Year Title
24362251 2014 Knockdown of CABYR-a/b increases chemosensitivity of human non-small cell lung cancer cells through inactivation of Akt.
22285430 2012 The expression and effects the CABYR-c transcript of CABYR gene in hepatocellular carcinoma.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21274509 2011 Expression of the sperm fibrous sheath protein CABYR in human cancers and identification of ?-enolase as an interacting partner of CABYR-a.
21240291 2011 CABYR binds to AKAP3 and Ropporin in the human sperm fibrous sheath.
20954286 2010 CABYR RNAi plasmid construction and NF-?B signal transduction pathway.
20731842 2010 CABYR isoforms expressed in late steps of spermiogenesis bind with AKAPs and ropporin in mouse sperm fibrous sheath.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...