Property Summary

NCBI Gene PubMed Count 10
PubMed Score 9.09
PubTator Score 4.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Polycystic kidney disease 1 21 3.345 1.7

Gene RIF (1)

AA Sequence

MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF      1 - 70
DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY     71 - 140
WLTGCRLR                                                                  141 - 148
//

Text Mined References (10)

PMID Year Title