Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.27
PubTator Score 1.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis -1.600 3.6e-04
osteosarcoma 1.520 4.2e-04
ovarian cancer 1.100 2.4e-03
Parkinson's disease -1.100 4.6e-02
psoriasis -1.200 1.9e-03

Gene RIF (4)

AA Sequence

MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDF      1 - 70
EKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAF     71 - 140
PETKLDKKKYPYWPHQPIENL                                                     141 - 161
//

Text Mined References (24)

PMID Year Title