Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.09
PubTator Score 1.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.200 0.002
osteosarcoma 1.520 0.000
Parkinson's disease -1.100 0.046
ovarian cancer 1.100 0.002
dermatomyositis -1.600 0.000

Synonym

Accession O75947 B2R5L6 Q9H3J4 ATPase subunit d
Symbols ATPQ

Gene

Gene RIF (4)

PMID Text
23857120 By merging results of a meta-GWAS, results in the CHARGE consortium data sets and an in vivo genotyping comprising 4501 individuals, detected a novel locus ATP5H/KCTD2 associated with Alzheimer's disease risk
22190034 HIV-1 Vpu is identified to have a physical interaction with ATP synthase, H+ transporting, mitochondrial Fo complex, subunit d (ATP5H) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
19110265 This protein has been found differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDF      1 - 70
EKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAF     71 - 140
PETKLDKKKYPYWPHQPIENL                                                     141 - 161
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23857120 2014 ATP5H/KCTD2 locus is associated with Alzheimer's disease risk.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19110265 2009 Proteomic analysis of dorsolateral prefrontal cortex indicates the involvement of cytoskeleton, oligodendrocyte, energy metabolism and new potential markers in schizophrenia.
19016746 2008 Identification of mitochondrial F(1)F(0)-ATP synthase interacting with galectin-3 in colon cancer cells.
More...