Property Summary

NCBI Gene PubMed Count 56
Grant Count 142
R01 Count 106
Funding $11,581,468.55
PubMed Score 111.42
PubTator Score 68.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.300 0.001
colon cancer -1.400 0.032
lung cancer 2.000 0.001
lung carcinoma 1.100 0.000
ovarian cancer 1.500 0.001

Synonym

Accession O75943 A8K8X2 D3DWA5 O75714 Q7Z3S4 Q9UNK7 Q9UNR7 Q9UNR8 Q9UPF5 hRad17
Symbols CCYC
R24L
RAD24
HRAD17
RAD17SP

Gene

Gene RIF (23)

PMID Text
25650659 Authors show that BRCA1 and RAD17 genes, whose derived proteins play a pivotal role in DNA damage repair, are transcriptional targets of gain-of-function mutant p53 proteins.
24971543 These data suggest that v-Src attenuates ATR-Chk1 signaling through the inhibition of Rad17-Rad9 interaction.
24923443 USP20 and Rad17 interact, and that this interaction is enhanced by UV exposure. We show that USP20 regulation of Rad17 is at the protein level in a proteasome-dependent manner. USP20 depletion results in poor activation of Chk1 protein by phosphorylation
24534091 Rad17 is phosphorylated by ATM at Thr622 resulting in a direct interaction of Rad17 with NBS1, facilitating recruitment of MRE11, RAD50 and ATM to the DNA double-strand breaks.
23687379 Our data suggest RAD17 as a novel target protein for gemcitabine combination therapy supplementing or complementing inhibition of CHK1.
23684611 Knockdown of Rad17 with two independent siRNAs significantly reduced Chk1 phosphorylation and substantial RPA32 Ser33 phosphorylation.
23637229 Data indicate that regulation of Rad17 turnover is through the Cdh1/anaphase-promoting complex pathway in breast cancer cells.
23383325 Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.
20424596 Proteolysis of Rad17 by Cdh1/APC regulates checkpoint termination and recovery from genotoxic stress
19275579 Rad17 is required for HIV-1 Vpr-mediated G2 arrest in Rad17-specific siRNA-transfected cells
More...

AA Sequence

MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLS      1 - 70
SLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQGGSILLITGPPG     71 - 140
CGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQ    141 - 210
MLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEEC    211 - 280
SISNISFNPVAPTIMMKFLNRIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENN    281 - 350
LRPRKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPRLP    351 - 420
SHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLL    421 - 490
REYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQ    491 - 560
LLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLG    561 - 630
EPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT                       631 - 681
//

Text Mined References (61)

PMID Year Title
25650659 2015 Gain of function mutant p53 proteins cooperate with E2F4 to transcriptionally downregulate RAD17 and BRCA1 gene expression.
24971543 2014 v-Src inhibits the interaction between Rad17 and Rad9 and induces replication fork collapse.
24923443 2014 Ubiquitin-specific peptidase 20 regulates Rad17 stability, checkpoint kinase 1 phosphorylation and DNA repair by homologous recombination.
24534091 2014 Rad17 recruits the MRE11-RAD50-NBS1 complex to regulate the cellular response to DNA double-strand breaks.
23687379 2013 Depletion of RAD17 sensitizes pancreatic cancer cells to gemcitabine.
23684611 2013 Two distinct modes of ATR activation orchestrated by Rad17 and Nbs1.
23637229 2013 Regulation of Rad17 protein turnover unveils an impact of Rad17-APC cascade in breast carcinogenesis and treatment.
23383325 2013 Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
More...