Property Summary

NCBI Gene PubMed Count 59
PubMed Score 113.57
PubTator Score 68.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 1.1e-11
ovarian cancer 8520 2.3e-05
group 3 medulloblastoma 4104 6.3e-04
colon cancer 1478 3.2e-02
lung cancer 4740 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.435 1.7
Bloom syndrome 29 3.027 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -1.400 3.2e-02
group 3 medulloblastoma 1.300 6.3e-04
lung cancer 1.600 4.3e-02
lung carcinoma 1.100 1.1e-11
ovarian cancer -1.100 2.3e-05

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (26)

AA Sequence

MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLS      1 - 70
SLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQGGSILLITGPPG     71 - 140
CGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQ    141 - 210
MLGDDLRTDKKIILVEDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEEC    211 - 280
SISNISFNPVAPTIMMKFLNRIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENN    281 - 350
LRPRKKGMSLKSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPRLP    351 - 420
SHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLL    421 - 490
REYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQ    491 - 560
LLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEALTDREHGMIDPDSGDEAQLNGGHSAEESLG    561 - 630
EPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT                       631 - 681
//

Text Mined References (64)

PMID Year Title