Property Summary

NCBI Gene PubMed Count 17
PubMed Score 94.91
PubTator Score 50.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.200 8.1e-04
diabetes mellitus -1.100 1.7e-03
mucosa-associated lymphoid tissue lympho... -1.343 2.2e-02
Multiple myeloma 1.452 7.8e-03
pancreatic cancer 1.100 1.6e-02

 GO Function (1)

Gene RIF (4)

AA Sequence

MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPT      1 - 70
HSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPM     71 - 140
SKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVG    141 - 210
VGTCGIADKPMTQYQDTSKYNVRHLMPQ                                              211 - 238
//

Text Mined References (25)

PMID Year Title