Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.80
PubTator Score 0.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.700 1.8e-02
atypical teratoid / rhabdoid tumor -1.400 9.3e-07
ependymoma -1.600 4.4e-02
glioblastoma -1.200 1.4e-04
medulloblastoma -1.100 9.1e-05
medulloblastoma, large-cell -1.600 1.4e-04
non primary Sjogren syndrome sicca 1.100 4.6e-02
oligodendroglioma -1.700 2.2e-02
osteosarcoma 1.224 1.2e-03
ovarian cancer -1.400 1.3e-07
psoriasis 1.200 6.8e-04

Synonym

Accession O75937 B4DUU4 D3DPM0 Q6IBA4 Q8N4Z5 Q9P051 Q9P067
Symbols SPF31
HSPC331

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTD      1 - 70
EEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQ     71 - 140
LKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKREREWQK    141 - 210
NFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKMEQRE                               211 - 253
//

Text Mined References (19)

PMID Year Title