Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.80
PubTator Score 0.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.700 0.018
ependymoma -1.600 0.044
oligodendroglioma -1.700 0.022
psoriasis 1.200 0.001
osteosarcoma 1.224 0.001
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.600 0.000
non primary Sjogren syndrome sicca 1.100 0.046
ovarian cancer 2.100 0.000

Synonym

Accession O75937 B4DUU4 D3DPM0 Q6IBA4 Q8N4Z5 Q9P051 Q9P067
Symbols SPF31
HSPC331

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human DnaJ (Hsp40) homolog, subfamily C, member 8 (DNAJC8) at amino acid residues 62-63 by the HIV-1 protease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFEVLQIDPEVTD      1 - 70
EEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEYVEHTVKERKKQ     71 - 140
LKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKREREWQK    141 - 210
NFEESRDGRVDSWRNFQANTKGKKEKKNRTFLRPPKVKMEQRE                               211 - 253
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...