Property Summary

Ligand Count 9
NCBI Gene PubMed Count 21
PubMed Score 300.66
PubTator Score 48.85

Knowledge Summary


No data available


  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.400 1.7e-09
atypical teratoid / rhabdoid tumor -3.400 2.0e-05
Breast cancer -5.400 5.7e-26
breast carcinoma -2.000 2.7e-04
cystic fibrosis -1.100 2.4e-03
esophageal adenocarcinoma -2.100 2.0e-02
glioblastoma multiforme 1.100 2.0e-07
group 3 medulloblastoma -3.100 1.5e-05
intraductal papillary-mucinous adenoma (... -2.100 1.1e-02
intraductal papillary-mucinous carcinoma... -2.100 1.9e-02
medulloblastoma, large-cell -3.600 2.1e-05
nephrosclerosis -2.336 1.7e-02
oligodendroglioma 1.100 1.0e-03
pituitary cancer -3.500 9.5e-09
posterior fossa group A ependymoma 1.200 2.6e-04
primitive neuroectodermal tumor -2.300 2.9e-02

 GWAS Trait (1)

Protein-protein Interaction (12)

Gene RIF (5)

AA Sequence

SYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN                                     351 - 387

Text Mined References (22)

PMID Year Title