Property Summary

NCBI Gene PubMed Count 20
Grant Count 63
R01 Count 31
Funding $6,483,852.88
PubMed Score 278.33
PubTator Score 48.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O75936 B2R8L7 D3DQZ1 Q6IBJ2
Symbols BBH
BBOX
G-BBH
gamma-BBH

Gene

PANTHER Protein Class (2)

PDB

3MS5   3N6W   3O2G   4BG1   4BGK   4BGM   4BHF   4BHG   4BHI   4C5W   4C8R   4CWD  

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20599753 the three-dimensional structure of recombinant human GBBH at 2.0A resolution was solved.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17110165 the use of 3 different promoters is responsible for the 5'-end heterogeneity

AA Sequence

MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFD      1 - 70
RKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKW     71 - 140
LSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLSFHTDYPALHH    141 - 210
PPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIEL    211 - 280
DDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRR    281 - 350
SYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN                                     351 - 387
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20599753 2010 Crystal structure of human gamma-butyrobetaine hydroxylase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17110165 2006 Genomic structure, alternative maturation and tissue expression of the human BBOX1 gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...