Property Summary

NCBI Gene PubMed Count 23
PubMed Score 14.50
PubTator Score 27.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1332 1.8e-03
oligodendroglioma 2850 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.243 1.8e-03
oligodendroglioma -1.400 3.9e-02

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF      1 - 70
ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE     71 - 140
NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK    141 - 210
QQHGEANKENIRQDF                                                           211 - 225
//

Text Mined References (28)

PMID Year Title