Property Summary

NCBI Gene PubMed Count 54
Grant Count 9
R01 Count 4
Funding $746,187.97
PubMed Score 59.05
PubTator Score 32.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.300 0.002
ependymoma -1.100 0.018
oligodendroglioma -1.200 0.003
psoriasis -3.800 0.000
osteosarcoma -1.666 0.002
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.900 0.000
lung cancer 1.200 0.003
active Crohn's disease 1.163 0.030
Breast cancer 2.400 0.027
adult high grade glioma -1.400 0.000
pilocytic astrocytoma -1.100 0.000
ovarian cancer -1.200 0.000

Synonym

Accession O75928 O75927 Q96BT5 Q96KE3
Symbols DIP
MIZ
MIZ1
SIZ2
ARIP3
PIASX
ZMIZ4
PIASX-BETA
PIASX-ALPHA

Gene

PANTHER Protein Class (1)

PDB

2ASQ   4FO9  

Gene RIF (10)

PMID Text
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
25484205 strategy for the purification of tethered POZ domains that form forced heterodimers is described, and crystal structures of the heterodimeric POZ domains of Miz1/BCL6 and of Miz1/NAC1 are reported
25434787 UXT is a binding protein of PIAS2, and interaction between PIAS2 and UXT may be important for the transcriptional activation of AR.
24344134 PIASxalpha is a novel SUMO E3 ligase for PTEN, and it positively regulates PTEN protein level in tumor suppression.
21156324 These findings suggest that SUMO-1 modification of MDA5 possibly via PIAS2beta may play a role in the MDA5-mediated interferon response to viral infections.
16713578 PIASxalpha acts as a key signal integrator that permits different responses from the same transcription factor, depending on the signaling pathway that is activated.
16460827 findings show that Epstein-Barr virus Rta interacts and colocalizes with PIASxalpha and PIASxbeta in the nucleus; these interactions seem to enhance Rta sumoylation
16148010 the repressive properties of PIASxalpha/ARIP3 require its physical interaction with FLI-1, identifying PIASxalpha as a novel corepressor of FLI-1
15580267 Required for upregulation of a large group of genes in response to DNA damage, a function that is regulated by c-Myc, but not by 14-3-3eta and represses the expression of many genes
12716907 PIASx may function as a co-repressor of Stat4

AA Sequence

MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLE      1 - 70
GLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIP     71 - 140
PVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQ    141 - 210
LRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISIS    211 - 280
WASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGK    281 - 350
MRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE    351 - 420
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKC    421 - 490
IFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGLDFLSLIPVD    491 - 560
PQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD             561 - 621
//

Text Mined References (63)

PMID Year Title
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25484205 2014 Structures of heterodimeric POZ domains of Miz1/BCL6 and Miz1/NAC1.
25434787 2015 Ubiquitously expressed transcript is a novel interacting protein of protein inhibitor of activated signal transducer and activator of transcription 2.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24344134 2014 PIASx? ligase enhances SUMO1 modification of PTEN protein as a SUMO E3 ligase.
22406621 2012 The SUMO E3-ligase PIAS1 regulates the tumor suppressor PML and its oncogenic counterpart PML-RARA.
More...