Property Summary

NCBI Gene PubMed Count 58
PubMed Score 65.19
PubTator Score 32.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.163 3.0e-02
adult high grade glioma -1.400 3.9e-04
astrocytic glioma -1.300 2.4e-03
Astrocytoma, Pilocytic -1.100 2.5e-06
atypical teratoid / rhabdoid tumor -1.500 1.7e-05
Breast cancer 2.400 2.7e-02
ependymoma -1.100 1.8e-02
glioblastoma -1.600 4.2e-05
lung cancer 1.200 3.3e-03
medulloblastoma, large-cell -1.900 3.8e-05
oligodendroglioma -1.200 3.3e-03
osteosarcoma -1.666 1.6e-03
ovarian cancer -1.200 1.6e-06
psoriasis -3.800 8.1e-06

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIRELYRRRYPRTLE      1 - 70
GLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGSVLLQDTKPTFEMQQPSPPIP     71 - 140
PVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQ    141 - 210
LRLCLAETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISIS    211 - 280
WASEIGKNYSMSVYLVRQLTSAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGK    281 - 350
MRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE    351 - 420
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKC    421 - 490
IFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGLDFLSLIPVD    491 - 560
PQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD             561 - 621
//

Text Mined References (65)

PMID Year Title